KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103015268
Entry
103015268         CDS       T03086                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00230  Purine metabolism
bacu00240  Pyrimidine metabolism
bacu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103015268 (DCK)
   00240 Pyrimidine metabolism
    103015268 (DCK)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     103015268 (DCK)
SSDB
Motif
Pfam: dNK Thymidylate_kin AAA_18 AAA_28 AAA_33 CoaE
Other DBs
NCBI-GeneID: 103015268
NCBI-ProteinID: XP_007193638
UniProt: A0A384B240
Position
Un
AA seq 260 aa
MATPPKRSCPSPAASPEGTRIKKISIEGNIAAGKSTFVNILKQVCEDWEVVPEPVARWCN
VQSAQDEFEELTTSQKSGGNVLQMMYEKPERWSFTFQSYACLSRIRAQLAALDGKLKDAE
KPVLFFERSVYSDRYIFASNLYESDCMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLRA
TPEKCLNRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNE
DFKDNHDSLVEKVKEFLSTL
NT seq 783 nt   +upstreamnt  +downstreamnt
atggccaccccacccaagaggagctgcccatctcccgcagccagccctgaggggacccgc
atcaagaaaatttccatcgaagggaacatcgctgctgggaagtcaacatttgtgaatatc
cttaaacaagtctgtgaggattgggaagtggttcctgaacctgttgccaggtggtgcaat
gttcaaagtgctcaggatgaatttgaggaactgacaacgtctcagaaaagtggtgggaat
gttcttcagatgatgtatgagaaacctgaacggtggtctttcaccttccagtcatatgcc
tgcctcagtcgaatacgagctcagcttgctgctctcgatggcaagctcaaagatgcggag
aaacctgtattattttttgaacgatctgtgtatagtgacaggtatatttttgcatctaat
ttgtatgaatctgactgcatgaatgaaacagagtggaccatttatcaagactggcatgac
tggatgaataaccagtttggccaaagccttgaactggatggaatcatttatcttcgagcc
actccagagaaatgcttgaatagaatatatttacggggaagaaatgaagaacaaggcatt
cctcttgaatacttagagaagcttcactataagcatgaaagctggctcctgcatagaaca
ctaaaaaccaactttgattatctacaagaagtgcctatcttaacactggatgttaatgaa
gactttaaagacaatcacgacagtctggttgaaaaggtaaaagaatttttgagcactttg
tga

DBGET integrated database retrieval system