KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103015775Help
Entry
103015775         CDS       T03086                                 

Gene name
MINPP1
Definition
(RefSeq) multiple inositol-polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00010  Glycolysis / Gluconeogenesis
bacu00562  Inositol phosphate metabolism
bacu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103015775 (MINPP1)
   00562 Inositol phosphate metabolism
    103015775 (MINPP1)
Enzymes [BR:bacu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     103015775 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     103015775 (MINPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: APS_kinase PUA_2 His_Phos_2 AAA_33 AAA_18 Arf RsgA_GTPase SID
Motif
Other DBs
NCBI-GeneID: 103015775
NCBI-ProteinID: XP_007182907
UniProt: A0A384A6H2
Position
Un
AA seq 622 aa AA seqDB search
MLRGPCRLFRVSVAPVAALAVALVSSLSRCSLLEPENRVVSPLSPYFGTKTRYEDANPGL
LPDPEAPRRDPQLLEETCTPVQLVALIRHGTRYPTTKQIRKLRQLHGLLRARGPGDDRTR
AAGGGGPXXXXXXXYADWMAGQLVEKGRQDMRQLALRLASLFPVLFSRENRGRLQLVTSS
KHRCVDSGAAFLQGLWQHYHPGLPPPDVADMECGPPRINDKLMRFFDHCEKFLTQVERNA
TALYHVEAFKTGPEMQNILKKVAGILQVPVNNLNADLIQVAFFTCSFDLAIKGVKSPWCD
VFDIDDAKETQQKSTNVVYQAHHVSRNKRGQVVGTRGGFRGCTVWLTGLSGAGKTTISFA
LEENLVSHAIPCYSLDGDNVRHGLNKNLGFSPWDREENIRRIAEVARLFADAGLVCITSF
ISPFAKDRENARKIHESAGLPFFEIFVDAPLNICESRDVKGLYKRARAGEIKGFTGIDSD
YEKPETPELVLKTNLSSVSDCVQQVVELLQEQNIVPHTIIKGIHELFVPENKLDQVRAEA
EVLPSLSITKLDLQWVQVLSEGWATPLKGFMREKEYLQVIHFGTLLDGMGFCFFVCLLLF
IIKEKSISQKFSQEQEMLILGL
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgctccgtggcccctgccgcctcttcagggtctccgtggcacccgtcgcggccctggct
gtggcgctggtctcgtcgctctctcgctgctccctcctggagccggagaaccgcgtggtc
tcgccgctcagcccctacttcggcaccaagactcgctacgaggatgccaaccccgggctg
ctgccggaccccgaggcgccacggcgggacccacagctgctggaggagacctgcaccccg
gtacagctggtcgccctcatccgccacggcacccgctacccgaccaccaaacagatccgc
aagctgcggcagctgcacggactgctgcgggcccgcgggcccggggatgaccggacccgc
gctgccggcggcggcggcccgnnnnnnnnnnnnnnnnnnnnntacgcggactggatggcc
gggcagctggtggagaaggggcggcaggacatgcgacagctggccctgcgcctggcctcc
cttttcccggtcctcttcagccgagagaaccgcggccgcctgcagctagtcaccagctcc
aagcaccgctgcgtggacagcggcgctgccttcctgcagggactgtggcagcactaccac
cctgggttaccgccgcccgacgtcgcagacatggagtgtggacccccaagaattaatgat
aaattaatgaggttctttgatcattgtgagaagtttttaactcaagtggaaaggaatgct
acggctctttatcatgtagaagccttcaaaactggaccagaaatgcagaacattttaaaa
aaagttgcaggtattttgcaagtgccagtcaacaacttaaatgcagatttaattcaggta
gcttttttcacctgttcatttgacctggcaattaaaggtgttaaatctccttggtgtgat
gtttttgacatagatgatgcaaaggagacccagcagaaatccaccaatgttgtgtatcag
gcgcatcatgtgagcaggaataagagagggcaggtggttggaacaaggggtggattccga
ggatgtaccgtgtggctgacaggtctctctggtgctggaaaaacaacgatcagttttgct
ctggaggagaatctcgtctcccacgccatcccttgctactccctcgatggggacaacgtc
cgtcatggcctcaacaaaaaccttggattctctccttgggacagagaagaaaacatccgc
cggattgctgaggtggccaggctgtttgccgacgctggtctggtctgcattaccagcttc
atttctccttttgcaaaggatcgtgagaatgcccgcaaaatccatgaatctgcaggactg
ccattctttgagatatttgtagatgcgcctctaaacatttgtgaaagcagagatgtaaaa
ggtctctacaaacgggcccgagctggggagatcaaagggtttacgggtattgattccgat
tatgagaaacctgaaactcctgagcttgtgcttaaaaccaatttgtcctcggtgagcgac
tgtgtgcagcaggtggtggaacttctacaggagcagaacattgtaccccacactataatc
aaaggcatccacgaactctttgtgccagaaaacaaacttgaccaagtccgagctgaggcc
gaagtgctcccttcgttatcaattaccaagctggatcttcagtgggtccaagttttgagt
gaaggctgggccactcccctcaaaggttttatgcgggaaaaggagtacttgcaggttata
cactttggcaccctgctagacggtatgggtttttgttttttcgtttgtttgttactcttt
attattaaagaaaaaagtatttctcagaagttttcacaggaacaagaaatgctaatcctt
ggtttgtaa

DBGET integrated database retrieval system