KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103016527
Entry
103016527         CDS       T03086                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchoring protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bacu01009]
    103016527 (AKAP5)
Protein phosphatases and associated proteins [BR:bacu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     103016527 (AKAP5)
SSDB
Motif
Pfam: WSK
Other DBs
NCBI-GeneID: 103016527
NCBI-ProteinID: XP_007184338
UniProt: A0A384AAJ4
Position
Un
AA seq 428 aa
MENTVPEIQVESKDEKRSAEVSPQNERQEEKASTLCFKRRKKAAKAMKPKAGSEAADAAR
KCSPEAGASDQPEPPGGAWASIKRLVTRSKRSDSSKQQKPFEAKVQPEINAEDDHSKKRA
KSRLKIPCIKFSKGEKRSNHSKIIEDSDCSIKVQREAGSLDTKTLTQSDDQAAKTKSKQH
VREDVSQKGSDEVCESNVNNSVTSPGEKVISVELELDTGHSAIQTGTLILEKDIEMLEEK
QSIQPQQASPLETSDTKHQLPVVSDVPPSPAVPDQQILEEARNSILESGPDWKDRESKET
VAEESKPKDTELSQESDFQVNEITAEKPKPEESKRMEPIAIIITDTEISEFDVKKSRNVP
KQFLISIENEQVGVFANDSGFESRTSEQYETLLIETASSLVKNAIQLSIEQLVNEMASDD
NAKSNLLQ
NT seq 1287 nt   +upstreamnt  +downstreamnt
atggagaacacagttcctgaaatacaagtagaaagcaaggatgagaagagatcagcagaa
gttagtcctcagaatgagaggcaggaggaaaaagcatcgacgctttgcttcaagagaaga
aagaaagcagccaaagcaatgaagcccaaagctggctctgaagctgctgatgcagcaagg
aagtgttccccagaagcaggagcctctgatcagccagagccccccgggggggcctgggcc
tccatcaaacgccttgtaacacgcagcaaaaggtcagattcttcaaagcagcaaaagccc
tttgaggccaaagtgcaacctgaaatcaatgctgaggatgatcattctaaaaaaagggca
aagtccagactcaagattccctgtataaaattctcaaaaggggagaaaagaagtaatcat
tccaaaattatagaagactcagactgcagtatcaaagtccaacgagaggctggaagtttg
gatacaaaaactctgacccaatcagatgaccaggcagcaaagaccaagtcgaagcagcat
gtaagggaagatgtctcacagaaagggagtgatgaggtctgtgaatcaaatgtgaacaac
agcgtaacttctcctggagagaaagtgatttcagtagaacttgagttagatacagggcat
tctgctattcaaacaggaactctaatccttgaaaaagacattgaaatgcttgaggaaaaa
caaagcatccaacctcagcaagcaagcccactggaaacttcagacacaaaacaccagctc
ccagtggtttctgatgttcctccctcacctgcagtcccagatcaacaaattctggaagaa
gccagaaacagtatcctagaaagtggaccagactggaaagaccgtgaaagtaaagagact
gttgctgaggagagtaagccgaaagatactgaactgagccaggaatcagattttcaagta
aatgaaatcactgcagaaaaacccaaaccagaagaaagcaaaagaatggagccaattgct
attattatcacagacactgaaatcagtgaatttgatgttaagaaatctagaaatgtccct
aagcaattcttaatttcaatcgaaaatgagcaagtgggggtttttgctaatgatagtggt
tttgagagtagaacttcagaacaatatgaaacactcttaatagaaacagcttcttctctt
gtcaagaatgctatccagttgtctatagaacagctggttaatgaaatggcctctgatgat
aatgcaaaaagcaatcttctacagtga

DBGET integrated database retrieval system