KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103016941Help
Entry
103016941         CDS       T03086                                 

Gene name
MARS2
Definition
(RefSeq) methionyl-tRNA synthetase 2, mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00450  Selenocompound metabolism
bacu00970  Aminoacyl-tRNA biosynthesis
bacu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    103016941 (MARS2)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    103016941 (MARS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bacu01007]
    103016941 (MARS2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bacu03016]
    103016941 (MARS2)
Enzymes [BR:bacu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     103016941 (MARS2)
Amino acid related enzymes [BR:bacu01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   103016941 (MARS2)
Transfer RNA biogenesis [BR:bacu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    103016941 (MARS2)
 Prokaryotic type
   Other AARSs
    103016941 (MARS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 DUF5600 D123
Motif
Other DBs
NCBI-GeneID: 103016941
NCBI-ProteinID: XP_007190533
UniProt: A0A384ATA8
Position
Un
AA seq 593 aa AA seqDB search
MLRISAFRLLGRTGASRLSLLEDFSLRHYSSDPLGVRDDTRDARAYFTTPIFYVNAAPHI
GHLYSALLADALCRHHRLRVPSAAATRFSTGTDEHGLKIQQAAAAAGLAPSELCDRVSAQ
FQQLFREADISSTDFIRTTEARHRIAVQHFWGVLKARGLLYKGLYEGWYCASDECFLPEA
KVTRQPGPSGDLCPVSLESGHPVSWTKEENYIFRLSQFREPLQRWLRGDPQAITPEPFHH
AVLQWLEEELPDLSVSRSSSHLHWGIPVPGDDSQTIYVWLDALVNYLTVIGYPNPEFKSW
WPTTSHIIGKDILKFHAIYWPALLLGAGMSPPHRIYVHSHWTVCGQKMSKSLGNVVDPRT
CLDRYTVDGFRYFLLRQGVPNWDCDYYGEKVVKLLDSELAFALGGLLNRCTANRINPSGT
YPAFCTTCFPSEPGLVGPTGRAQAEDYALVSAVATLPKQVADHYDNFQIYKALEAVSSCV
RQTNGFVQRHAPWKLNWESPVDAPWLGTVLHVALECLRVFGTLLQPVTPSLADKLLSRLG
VSATERGFGELHFLPRFYGHPCPFEGRRLGPETGVLFPRLDQSRAWLVKAHKT
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggatttctgcctttcggctgctaggacgcacgggggcgagtaggctctcgctc
ctggaggactttagcttacgccactacagttcggaccctctcggtgtccgggacgatacc
cgcgacgcgcgcgcctacttcaccacacccatcttctacgtgaacgcggcgccgcatatc
gggcacctgtactcggcgctactggctgacgccttgtgccgacaccatcgcctccgagtt
cccagcgccgccgccacgcgattctccactggtaccgatgagcacggcctcaagattcag
caggcagcagccgctgcgggcctggctccgtccgagctgtgcgacagagtctctgcccag
ttccagcagcttttccgggaggctgacatctcctccaccgacttcatccgcaccactgag
gcccggcatcggatagctgtgcagcacttctggggggtgctgaaggctcggggtcttctc
tacaaggggctctatgaaggttggtattgcgcctccgacgagtgcttcctgcctgaagcc
aaggtcaccaggcagcccggcccgtcgggggatttgtgtcctgtatctctggagagcggg
catcccgtctcctggaccaaggaagaaaactacattttcaggctttcccagttccgggag
ccgctccagcggtggctgcggggcgaccctcaggccatcaccccggagccattccatcac
gcagtccttcagtggctggaagaggagctgccggacctatccgtctctcgaagcagtagc
cacttgcactggggcattccggtgcccggggacgattcgcagaccatctacgtatggctg
gatgccttggtcaactaccttactgtaattggctacccaaaccctgagttcaaatcttgg
tggcctacgacctctcatatcataggcaaggacattctcaaattccatgctatctattgg
cctgccctcctcttaggggccggcatgagcccaccacaccgcatctatgttcactcccac
tggacagtctgtggtcaaaagatgtctaagagcttgggcaacgtggtggatcccaggaca
tgccttgaccgctatactgtggatggcttccgctactttctccttcgtcagggtgtcccc
aactgggactgtgattactatggtgaaaaggtggttaagttgttggattccgagctggca
tttgctttgggaggtctcttgaaccgatgcactgccaacagaataaatccttctgggacc
tatccggctttttgcactacctgctttcccagtgagccagggttggtggggccaacaggt
cgtgctcaggcagaggactatgctctggtgagcgcagtggccactttgcccaagcaggtg
gcagaccactatgataactttcagatctataaggctctggaggcagtatccagctgtgtc
cggcaaactaatggctttgtccaaaggcatgcaccatggaagttgaactgggagagccca
gtggatgctccctggctgggtactgtgcttcatgtggccttggaatgtttgcgagtcttt
ggaactttgctccaacctgtcaccccaagcctagctgacaagctgctgtctaggttgggg
gtctctgccacagagaggggctttggagagctccatttcttgcctcgattctatggacat
ccatgcccttttgaagggaggaggctgggacctgaaactggggtcttgtttccaagactg
gaccagtccagggcctggctggtaaaagcccataagacctag

DBGET integrated database retrieval system