KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103018249Help
Entry
103018249         CDS       T03086                                 

Gene name
INSR
Definition
(RefSeq) insulin receptor
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04022  cGMP-PKG signaling pathway
bacu04066  HIF-1 signaling pathway
bacu04068  FoxO signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04150  mTOR signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04152  AMPK signaling pathway
bacu04211  Longevity regulating pathway
bacu04213  Longevity regulating pathway - multiple species
bacu04520  Adherens junction
bacu04910  Insulin signaling pathway
bacu04913  Ovarian steroidogenesis
bacu04923  Regulation of lipolysis in adipocytes
bacu04930  Type II diabetes mellitus
bacu04931  Insulin resistance
bacu04932  Non-alcoholic fatty liver disease (NAFLD)
bacu04960  Aldosterone-regulated sodium reabsorption
Module
bacu_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103018249 (INSR)
   04015 Rap1 signaling pathway
    103018249 (INSR)
   04010 MAPK signaling pathway
    103018249 (INSR)
   04066 HIF-1 signaling pathway
    103018249 (INSR)
   04068 FoxO signaling pathway
    103018249 (INSR)
   04072 Phospholipase D signaling pathway
    103018249 (INSR)
   04022 cGMP - PKG signaling pathway
    103018249 (INSR)
   04151 PI3K-Akt signaling pathway
    103018249 (INSR)
   04152 AMPK signaling pathway
    103018249 (INSR)
   04150 mTOR signaling pathway
    103018249 (INSR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103018249 (INSR)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103018249 (INSR)
   04923 Regulation of lipolysis in adipocyte
    103018249 (INSR)
   04913 Ovarian Steroidogenesis
    103018249 (INSR)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103018249 (INSR)
  09149 Aging
   04211 Longevity regulating pathway - mammal
    103018249 (INSR)
   04213 Longevity regulating pathway - multiple species
    103018249 (INSR)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    103018249 (INSR)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    103018249 (INSR)
   04931 Insulin resistance
    103018249 (INSR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103018249 (INSR)
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:bacu04090]
    103018249 (INSR)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103018249 (INSR)
Protein kinases [BR:bacu01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   103018249 (INSR)
CD molecules [BR:bacu04090]
 Proteins
  103018249 (INSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain Pkinase Furin-like fn3 Kinase-like B2 DUF4476
Motif
Other DBs
NCBI-GeneID: 103018249
NCBI-ProteinID: XP_007169138
Position
Un
AA seq 1316 aa AA seqDB search
MFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYALVIFE
MVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNEECGD
ICPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHGCTAEGLCCHSECLGNCS
EPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWRCVNFSFCQDLHNKCKNSRRQGCHQY
VIHNNKCIPECPSGYTMNSSNLMCTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGCTIIN
GSLIINIRGGNNLAAELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGETLEIGN
YSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQERNDI
ALKTNGDQASCENELLKFSYIRTSYDKILLKWEPYWPPDFRDLLGFMLFYKEAPYQNVTE
FDGQDACGSNSWTVVDIDPPMRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFSDERR
TYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWERQEE
DGELYELDYCLKGLKLPSRTWSPPFESEGSQKHNQSEYEDSAGECCSCPKTDSQILKELE
ESSFRKTFEDYLHNVVFIPRKSSSGPVAEDTRPSRKRRALGDVGNVTAAVPTIPGFPNTS
STSAPTSSEEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDSPERCSVAAYVSARTM
PEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGEEELHLCVSRRHF
ALERGCRLRGLPPGNYSVRVRATSLAGNGSWTEATYFYVTDYYVPSNIAKIIIGPLIFVF
LFSVVIGSIYLFLRKRQPDGPLGPLYASSNPEYLSASDVFPCSVYVPDEWEVPREKITLL
RELGQGSFGMVYEGNARDIVKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHV
VRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADG
MAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPE
SLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVT
DLMRMCWQFNPKMRPTFLEIVDLLKDELHPSFPEVSFFHSEENKVPESEELEMEFEDMES
VPLDRSSHAQREEAGGRDGGSALGLKRNYEEHIPYTHMNGGKKNGRILTLPRSNPS
NT seq 3951 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaaacgagacctgaggacttccgagacctcagtttccccaagctcatcatgatc
actgattacttgctgctcttccgggtctacgggctggagagcctgaaggacctgttcccc
aacctcacggtcatccggggctcccgcctcttctttaactacgcgctggtcatcttcgag
atggttcacctgaaggagcttggcctctacaacttgatgaacatcacccggggctccgtc
cgcatcgagaagaacaatgaactctgctacctggccaccatcgactggtctcgcatcctg
gattccgtggaggataattacatcgtgctgaacaaagacgacaatgaggagtgtggggac
atttgtcccggcaccgcgaagggcaagaccaactgccctgccaccgtcatcaacgggcaa
tttgtggagcggtgttggacgcacagccactgccagaaagtgtgtccgaccatctgtaag
tctcacggctgcaccgctgagggtctctgttgccacagtgagtgcttgggcaactgctct
gagcctgacgaccccaccaagtgtgtggcctgtcgcaacttctacctggatggcaggtgc
gtggagacctgcccgcccccctactaccacttccaagactggcgctgtgtgaacttcagc
ttctgccaggacctgcacaacaaatgcaagaactctcggaggcagggctgccaccagtat
gtcattcacaataacaagtgcatccctgagtgcccctctgggtacacgatgaattccagc
aacttgatgtgcactccatgcctgggcccctgtcccaaggtgtgccacctcctggaaggc
gagaagaccattgactcagtgacatctgcccaggagctccgaggctgcaccatcatcaac
ggaagcttaatcatcaacatccgagggggcaacaacctggcagctgagctagaggccaac
cttggactcattgaagaaatttcagggtatctgaaaatccgtcgatcatatgcactcgtg
tcactttccttcttccggaagttacgtctgattcgaggggagaccttggaaatcgggaac
tactctttctatgccttggacaaccagaacctaaggcagctgtgggactggagcaaacac
aacctcaccatcactcaggggaaactcttcttccactataatcccaaactctgcttgtca
gaaattcacaagatggaggaagtttccggaaccaaggggcgccaggagagaaacgacatt
gccctgaagaccaatggggaccaggcgtcctgcgaaaatgaattacttaaattttcttac
attcggacatcttatgacaagatcttgctgaaatgggagccgtattggccccccgacttc
cgagacctcctgggattcatgctcttctacaaagaggccccttatcagaacgtgacggag
tttgatgggcaggacgcgtgtggttccaacagctggaccgtggtggatattgacccgcct
atgaggtccaacgaccccaagtcacagaaccaccctgggtggctaatgcgtggtctcaag
ccctggacccagtacgccatctttgtcaagaccttggtcaccttttctgatgaacgccgc
acatacggggccaagagcgacatcatctatgtccagacagatgccactaatccttctgtc
cccctggatcccatctcggtgtctaattcttcgtcccagattattctgaagtggaagcct
ccctctgaccccaatggcaacatcacacactacttggtattctgggagagacaggaggaa
gacggtgaactgtatgaattagattattgcctcaaagggttgaagctgccctcccggacc
tggtctccaccgttcgagtctgaggggtcccagaagcacaatcagagtgagtacgaagac
tctgccggtgaatgctgttcctgcccgaagaccgactctcagatcctcaaggagctggag
gagtcctcattccggaaaacgttcgaagattacctgcacaacgtggttttcatccccaga
aaatcctcttcaggccctgttgccgaggacactaggccgtcgaggaaacgcagggccctt
ggtgatgtggggaatgtgacagcagccgtgcccaccattccgggattccccaatacgtcc
tcaaccagcgcacctacgagctcagaggagcacagaccattcgagaaagtggtgaacaag
gagtctctggtcatctctggcctgcggcactttactggctatcgcattgagctgcaggct
tgcaaccaagactcccccgagaggtgcagcgttgctgcatatgtcagtgccaggaccatg
cccgaagccaaggcagatgatattgttggccccgtgacccacgaaatcttcgaaaacaac
gtcgttcacttgatgtggcaggagcccaaggaacccaacggtctgatcgtgctgtacgaa
gtgagttatcgacgatacggcgaagaggagctgcatctctgcgtctcccgcaggcatttt
gctctggagcggggctgcaggctgcgtggtctgccacccgggaattacagtgtgcgagtt
cgggccacctccctggcgggcaatggctcctggacggaagccacctatttctacgtcaca
gactattacgtaccatcaaatattgcaaaaattatcatcggccccctcatctttgtcttt
ctcttcagtgttgtgatcggaagcatttatctattcctgagaaagaggcagccggatggg
ccactgggaccactgtatgcttcttcaaaccctgagtacctcagtgccagcgatgtgttt
ccctgctctgtgtacgtgccggatgagtgggaggtgcctcgagagaagatcacgctcctg
cgagaactggggcagggctccttcggcatggtgtacgagggcaacgccagggacattgtc
aagggcgaggcggagacccgagtggcagtgaagacggtcaacgagtctgccagcctgcga
gagcggatcgaatttctcaacgaggcctcggtcatgaagggcttcacctgccaccacgtg
gtccgcctcctgggggtggtatccaaaggccagccgacgctggtggtgatggagttgatg
gctcacggggacttgaagagctacctccgttccctgcggcctgaggccgagaataacccc
ggccgccctccccctaccctgcaagagatgattcagatggctgcggagatcgccgacggg
atggcatacctgaacgccaagaagtttgtacaccgggacctcgcagctcgaaactgtatg
gtcgcccacgattttactgtcaaaattggagactttggaatgaccagagacatctacgaa
acggattactaccggaaagggggaaagggtctgctccccgtgcggtggatggcacctgaa
tccctgaaggacggggtctttaccacttcttcggacatgtggtcctttggcgtggtcctt
tgggaaattaccagcttggcggaacagccttaccaaggcctatcaaacgagcaggtgtta
aaatttgtcatggatggagggtatctggatcaacccgacaattgtccagagagagtcacc
gacctgatgcgcatgtgctggcagttcaaccccaagatgcggccgaccttcctggagatt
gtcgacctgctcaaggacgagctgcaccccagtttccccgaagtttccttcttccacagc
gaggagaacaaggtgcccgagagcgaggagctggagatggaatttgaggacatggagagt
gtccccctggaccggtcgtcacatgcgcagagggaggaggccgggggccgggatggaggg
tccgcgctggggctaaagagaaactatgaggagcacatcccctacacccacatgaacggg
ggcaagaaaaacggacgcattctgactctgccccggtctaatccttcctaa

DBGET integrated database retrieval system