KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103018459
Entry
103018459         CDS       T03086                                 

Gene name
TM7SF2
Definition
(RefSeq) transmembrane 7 superfamily member 2
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00100  Steroid biosynthesis
bacu01100  Metabolic pathways
Module
bacu_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    103018459 (TM7SF2)
Enzymes [BR:bacu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     103018459 (TM7SF2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 103018459
NCBI-ProteinID: XP_007174523
UniProt: A0A383ZH93
Position
Un
AA seq 399 aa
MAPQGSQAELEFGGPLGAAALLLLLPATMFHLLLVARSGPARLLERGLARRKTPSTLSTL
LCPQVAEGQELKDKSRLRYPINGFQALVLTALLVGLGVSAGLPLSALPEMLLPLAFAATL
TAFIFSLLLYLKALVAPASALAPGGNSGNPIYDFFLGRELNPRICSFDFKYFCELRPGLI
GWVLINLALLMQEAELRGSPSLAMWLVNGFQLLYVGDALWHEEAVLTTMDIIHDGFGFML
AFGDLAWVPFTYSLQAQFLLYHPEPLGLPLASVICLINAVGYYIFRGANSQKNTFRKNPS
DPRVADLETISTATGRRLLVSGWWGMVRHPNYLGDLIMALAWSLPCGVSHLLPYFYLLYF
TALLVHREARDEQQCLQKYGLAWHAYCQRVPYRIVPYIY
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggcccctcagggctcccaggccgagctggaattcggaggacccctgggcgctgcggcg
ctgctgctgctgcttcccgccaccatgttccacctgctgctggtagcccgctcgggcccg
gcgcgcctcctggagaggggcttggcgagaagaaagacaccctcaacccttagcaccctt
ttgtgcccacaggtggccgaggggcaggaactgaaggacaagagtcgactgcgctacccc
attaacggcttccaggccctggtgctgacagccctgttggtgggcctgggggtgtcagcc
gggctgcccctgagcgcgctcccggaaatgctcctgcccttggcctttgcggccaccctc
accgccttcatcttcagcctccttctctatctgaaggctctggtagcccctgcctctgcc
ctggcacccggggggaactcaggcaatcccatttacgactttttcctgggacgggagctc
aacccgcgcatctgttcctttgacttcaaatatttctgcgaactgcggcctggcctcatc
ggctgggtcctcatcaacctggccttgctgatgcaggaagcagaacttcgggggagtccc
tcactggccatgtggctggtcaatggcttccagctactatatgtgggtgatgccctttgg
cacgaggaggcggtcctcaccaccatggacatcatacacgacgggtttggcttcatgctg
gcctttggggacctcgcctgggtacccttcacctacagcctgcaggcccagttcctgctg
taccacccagagcccctggggttgcccctggcctcggtcatctgcctcatcaatgctgtt
ggttactacatcttccgtggagccaattctcagaaaaacaccttccggaagaatccttct
gatcccagagtggctgaccttgagaccatctctacagccacagggcgacggctgctggtg
tctgggtggtggggtatggtccgccatcccaactaccttggagacctcatcatggctctg
gcctggtccttgccctgcggggtgtcccacctgttgccctacttctacctcctttacttc
actgcgctgttggtacaccgtgaggcccgggatgagcagcagtgtctgcagaagtatggc
ctggcctggcacgcatactgccagcgtgtgccctatcgaatcgtgccctacatctactga

DBGET integrated database retrieval system