KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103018510Help
Entry
103018510         CDS       T03086                                 

Gene name
QDPR
Definition
(RefSeq) quinoid dihydropteridine reductase
  KO
K00357  dihydropteridine reductase [EC:1.5.1.34]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00790  Folate biosynthesis
bacu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    103018510 (QDPR)
Enzymes [BR:bacu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     103018510 (QDPR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 Epimerase PRMT5
Motif
Other DBs
NCBI-GeneID: 103018510
NCBI-ProteinID: XP_007187667
UniProt: A0A384AJX4
Position
Un
AA seq 242 aa AA seqDB search
MAAVAGETRRVLVYGGRGALGSRCVQAFRARNWWVASIDVVENEEASASVLVKMTDSFTE
QADQVTAEVGKLLGAEKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSMWTSTISSHLA
TKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKDSGMPSGSAAIAVLP
VTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITEKNRPSSGSLIQVVTTKGRTELTPA
YF
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtagcaggcgagacgcgccgggtgctggtgtacggcggcaggggcgcgctg
ggctcccgatgcgtgcaggcgttccgcgcccgcaactggtgggtcgccagcatcgacgtg
gtggagaatgaagaggccagtgccagcgtcctggttaaaatgacagactcgtttacggag
caggctgaccaggtgaccgctgaggttggaaagctcttgggtgcagagaaggtggacgcg
atcctttgtgtggctggaggatgggctgggggcaatgccaagtccaagtctctctttaaa
aactgtgacctgatgtggaagcagagcatgtggacgtcgaccatctccagccacctggcc
accaagcacctcaaggaaggaggcctcctgaccttggcaggggccaaggccgccctggat
gggactccggggatgattggctacggcatggccaagggtgcggttcaccagctttgccag
agcctggccgggaaggacagcggcatgccgtccgggtctgctgccatcgccgtgctcccg
gttaccctggacacaccgatgaacaggaaatcaatgcctgaggccgatttcagctcctgg
acgcccttggaattcctagtcgaaaccttccatgactggatcacagagaaaaaccgacca
agctcaggaagcctaatccaggtggtaaccacaaagggaaggacggagcttaccccagcg
tatttttaa

DBGET integrated database retrieval system