KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103019376Help
Entry
103019376         CDS       T03086                                 

Gene name
THNSL2
Definition
(RefSeq) threonine synthase like 2
  KO
K06037  O-phospho-L-threonine phospho-lyase [EC:4.2.3.-]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    103019376 (THNSL2)
Enzymes [BR:bacu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.-  
     103019376 (THNSL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 103019376
NCBI-ProteinID: XP_007175372
UniProt: A0A383ZJV1
Position
Un
AA seq 484 aa AA seqDB search
MWYVSTRGMAPRVDFEGALFSGYAPDGGLYMPEELPQLDRETLRQWSVLSYPSLVKELCS
LFIGPELIPRDDLNDLIDRAFSRFRHKEVVHLSRLRNGLNVLELWHGVTYAFKDLSLCCA
ARFLQYFLEKRKKHITVVVGTSGDTGSAAIESVQGAENVDLIVLLPKGRCTKIQELQMTT
VLRENVHVFGVEGNSDELDEPIKAVFADVAFVKEHNLMSLNSVNWSRVLVQMAHHFFAYF
RCAPALDLHPLPPVEVVVPSGAAGNLAAGFIAQKMGLPIHLVVAVNYNDIIHRTVQRGDF
SLSEAVKPTLASAMDIQVPYNMERIFWLLAGSDSQVTRALMEQFERTGSVSLPKELHSKL
SEAVTSQSVSDEAIIQTMGRCWEENQYLLCPHSAVAVSYHYQQADRRQPSPPRSCLAPAS
AAKFPEAVLAAGLTPETPAEILALEHKEARCTPMRKGDDWTRMLRGLIEDLSRQRQGRFR
KAPA
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgtggtacgtcagtactcgggggatggccccacgggttgactttgaaggggcccttttc
tctggctatgctccggatgggggcctctacatgcccgaggagctccctcagctggacaga
gagaccctgcgtcagtggagtgtgctctcctaccccagcctggtgaaggagctgtgtagc
ctcttcattgggcccgagctcattccaagagatgacttaaatgatctgatcgaccgagcc
ttcagcagattccgacacaaagaggtggtccatctatccaggttgaggaatgggctgaac
gtgctggagctgtggcatggggtcacctatgcgtttaaggacctgtccctgtgctgtgct
gcacggttcctgcagtacttcctggagaagaggaagaagcacatcaccgtggttgtagga
acttctggggacacggggagtgctgccatcgagagtgttcagggggcagagaacgtggac
ctcattgttctgctgcccaaaggtcgctgcacaaaaattcaggagctccagatgacgaca
gtgctgagagagaatgtccacgtgtttggagtggaggggaacagcgatgagctggacgag
cccatcaaggccgtgtttgccgacgtggcctttgtcaaggagcacaacctgatgagtctg
aattcagtcaactggtcccgcgtcctcgtgcaaatggcccaccacttcttcgcttatttc
cggtgtgcgccagccttagacttgcacccactgccccccgtggaggtggttgtaccatcg
ggggctgccggtaacctcgcagctgggttcatcgctcagaagatgggcctgcccatccac
ctggtcgtggcagtgaactacaatgacatcatccacaggaccgtccagcggggagacttc
tctctgtctgaggccgtcaaaccaaccttggcatcagctatggacattcaggtgccgtac
aacatggagaggatcttctggctgctagctggctctgacagccaggtgacaagagccctc
atggagcagtttgaaaggaccggaagtgtgagtctacccaaggaattgcacagcaagctt
tcagaggcagtaacgtctcagtcagtgtcagacgaggccatcatccagaccatgggccgc
tgctgggaagagaaccagtacttgctgtgccctcactcggccgtggccgtgagctaccat
taccagcaggcggacaggcggcagcccagccctccccgctcttgtctggctcccgcctct
gcagccaagttcccggaggccgtgctggctgccgggctgaccccggagactcccgcggag
atcctcgccctggagcacaaggaggcgcgctgtaccccgatgcggaagggtgacgactgg
acgcggatgcttcggggcctgattgaggacctgagccggcagcggcaggggcgcttccgg
aaagcgccggcgtag

DBGET integrated database retrieval system