KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103019933Help
Entry
103019933         CDS       T03086                                 

Gene name
TSPAN12
Definition
(RefSeq) tetraspanin 12
  KO
K17355  tetraspanin-12
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    103019933 (TSPAN12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tetraspanin
Motif
Other DBs
NCBI-GeneID: 103019933
NCBI-ProteinID: XP_007177319
UniProt: A0A383ZQW8
Position
Un
AA seq 305 aa AA seqDB search
MAREDSVKCLRCLLYALNLLFWLMSISVLAVSAWMRDYLNNVLTLTAETRVEEAVILTYF
PVVHPVMIAVCCFLIIVGMLGYCGTVKRNLLLLAWYFGSLLVIFCVELACGVWTYEQEIM
VPVQWSDMVTLKARMTNYGLPRYRWLTHAWNFFQREFKCCGVVYFTDWLEMTEMDWPPDS
CCVKEFPGCSKQAHQEDLSDLYQEGCGKKMYSFLRGTKQLQVLRFLGISIGVTQILAMIL
TITLLWALYYDRREPGTDQMTALKNDTTQHLPCHSVELLKPSLSRIFEHTSMANSFNTHF
EMEEL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggccagagaagattctgtgaagtgtttgcgctgcctgctctacgcgctcaatctgctc
ttttggttgatgtccatcagcgtgttggcagtttccgcttggatgagggactacctaaat
aatgttctgactttaactgcagaaacaagggtagaggaggctgtcatcttgacttatttt
cctgtggttcatccggtcatgattgctgtttgctgtttcctgatcatcgtggggatgtta
ggatactgtggaacagtaaaaagaaatctcttacttcttgcatggtattttggaagttta
cttgtcattttctgtgtagaactggcttgtggtgtttggacatatgagcaggaaattatg
gttccagtacagtggtcagacatggtcactttgaaagccagaatgacaaattatggctta
ccgagataccggtggcttactcatgcttggaatttttttcagagagagttcaagtgctgt
ggagttgtctatttcaccgactggctggaaatgacagaaatggactggcccccagattcc
tgttgtgttaaggaattcccaggatgttccaaacaggcccaccaggaagatctcagtgac
ctttatcaagagggttgtgggaagaagatgtattcttttttgagaggaaccaaacaactg
caggtgctcaggttcctggggatctccattggggtgacacagatcctggccatgattctc
accattactctgctctgggctctctactatgatagaagggagcctgggacagaccaaatg
acggccctgaagaatgacaccactcagcacctgccttgtcactcagtggaactgttgaaa
ccaagcctgtcaaggatctttgaacacacatccatggcaaacagctttaacacacacttt
gagatggaggaattatag

DBGET integrated database retrieval system