KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103020596Help
Entry
103020596         CDS       T03086                                 

Gene name
GPX8
Definition
(RefSeq) glutathione peroxidase 8 (putative)
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00480  Glutathione metabolism
bacu00590  Arachidonic acid metabolism
bacu01100  Metabolic pathways
bacu04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    103020596 (GPX8)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    103020596 (GPX8)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    103020596 (GPX8)
Enzymes [BR:bacu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     103020596 (GPX8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 103020596
NCBI-ProteinID: XP_007195651
UniProt: A0A384B7G2
Position
Un
AA seq 209 aa AA seqDB search
MEPLTAYPLRCSGPKAKVFAVLLSMVLCTVMLFLLQLKFLKPKINSFYTFEVKDANGRTV
SLEKFKGKVALVVNVASDCQLTDRNYLALQELHKEFGPFHFSVLAFPCNQFGESEPRPSK
EVVSFARNNFGVTFPIFHKIKILGPEAEPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVKS
WRPEEPIEIIRPEIAALIRQMIIKKKEDL
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggagcctctcacagcctaccctttgagatgttcagggcccaaagcaaaggtatttgca
gttttgctgtctatggttctatgtacagtaatgttatttcttctacaactaaaattccta
aaacctaaaatcaacagcttttatacatttgaagtgaaagatgcaaatggaagaacggtt
tctctggaaaagtttaaaggcaaagttgcactagttgtaaacgtggctagtgactgccaa
ctcacagacagaaattacttagcactgcaggaactgcacaaagagtttggaccattccac
ttcagcgtcttggcttttccatgcaatcagtttggagaatcggagccccgcccaagcaag
gaagtagtatcttttgcaagaaataacttcggagtaacattccccatcttccacaagatt
aagattctaggacctgaagcagaacctgcatttagatttcttgttgattcgtcaaagaag
gaaccaagatggaatttctggaagtacctggtcaaccctgaaggtcaagttgtgaaatct
tggaggccagaggaacccattgaaatcatcaggcctgagatagcagctctgattagacaa
atgatcataaaaaagaaagaggatctatga

DBGET integrated database retrieval system