KEGG   Bacillus sp. WP8: QR42_00255Help
Entry
QR42_00255        CDS       T03530                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bacw  Bacillus sp. WP8
Pathway
bacw00450  Selenocompound metabolism
bacw00970  Aminoacyl-tRNA biosynthesis
bacw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bacw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    QR42_00255
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    QR42_00255
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bacw01007]
    QR42_00255
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bacw03016]
    QR42_00255
Enzymes [BR:bacw01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     QR42_00255
Amino acid related enzymes [BR:bacw01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   QR42_00255
Transfer RNA biogenesis [BR:bacw03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    QR42_00255
 Prokaryotic type
   Other AARSs
    QR42_00255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f tRNA-synt_1c tRNA-synt_1d NYD-SP28
Motif
Other DBs
NCBI-ProteinID: AIZ58814
UniProt: A0A0B4S4E4
Position
48034..50034
Genome map
AA seq 666 aa AA seqDB search
MPEKKKTFYLTTPIYYPSGKLHIGHAYTTVAGDAMARYKRLQGYDVMYLTGTDEHGQKIQ
QKAEEQNITPIEYLDPVVEDIKSLWKKLDISNDDFIRTTEKRHTKIIEQVFQKLLDQGDI
YLDQYEGWYSIPDETFYTETQLVDVERNEKGEVIGGKSPDSGHPVELIKEESYFFRMSKY
ADRLLDYYEKNPSFIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPNNPKHVIYVW
IDALFNYLTAIGYGTDQDEKYKKYWPANVHLVGKEIVRFHTIYWPIMLMALDLPLPKQIF
AHGWLLMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGADGVFTPEGFVERVN
YDLANDLGNLLNRTVAMVQKYFDGTLSSYKGPVNEFDEELKAVAEQTVKAYEEAMENLEF
SVALSNVWTLISRTNKYIDQTAPWVLAKDETKRKELHSVMYHLAESLRITAVLLTPFLTK
TPEKIFFQLGIEEEKLKNWDSILSFGAIQHATVQKGEPLFPRLEVEEEVAYIKEKMQGSA
PKVEEEKVEIEETELPELGAEIAFDDFSKVDLRVAQVLEVAPVKKADRLLKLQLDFGFEK
RQIVSGIAKHYQPEELVGKKLVCVANLTPVKLRGEISQGMILTGETGGKLQVLEVDQSLA
NGTKIL
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgccagaaaagaaaaaaacgttttatctgacaacacctatttactatccgagcggaaaa
ttacatattggacatgcttatacgacagtagcgggagatgctatggctcgttataaacgt
cttcaaggctatgatgtgatgtatttaacgggtacagatgaacacggacaaaaaattcag
caaaaagctgaagaacaaaatatcacaccaatcgagtatttagatccagtcgttgaagac
attaaatcattatggaagaaactcgacatttcgaatgacgacttcatccgtacaacagaa
aaaagacatacgaaaatcatcgagcaggtattccaaaaacttcttgatcaaggcgatatt
tatttagatcaatatgagggctggtacagtattcctgatgagacattctatacggaaaca
cagcttgttgatgttgagcgtaatgagaaaggggaagtcattggcgggaaaagccctgac
agcggacaccctgttgaattaattaaagaggaatcatatttcttccgtatgagtaagtat
gcggatcgtttgctcgattattacgaaaagaatccatcgtttattcagcctgaatcaaga
aagaatgaaatgattaataacttcattaaaccaggtttagaggatttagccgtatcaaga
acaacctttgattggggaattaaagttcctaacaatccaaaacacgtcatttatgtatgg
attgatgcgttattcaactatttaactgcgattggctatggaactgatcaagatgagaaa
tataaaaaatattggcctgccaacgtacatctcgtaggaaaagaaattgtacgcttccat
acgatttattggccgattatgttgatggcattagatctgcctctaccgaagcaaattttc
gcacacggctggctgctcatgaaagatggcaaaatgtctaaatcaaaagggaatgtggta
gatccggtcacattaattgatcgctatggcctcgatgccctccgttattatctgcttcgc
gaagtaccatttggtgcggatggtgtgtttacaccagaaggattcgtggaacgtgtaaac
tatgaccttgccaatgatttaggtaacttgcttaatcgtacagttgcgatggtccaaaaa
tattttgacggcactttaagcagctataagggccctgttaatgagtttgatgaagagctg
aaagcagtcgctgagcaaaccgtcaaagcctatgaagaggcgatggaaaaccttgaattc
tctgtggctctttcaaatgtttggacattaatcagcagaaccaataaatatattgatcaa
acagctccatgggtgctggcaaaggatgaaacaaaacgaaaagaattgcattctgttatg
tatcatttagcagaatcacttcgaatcacagcagtcctcttaacgccattcctaacgaaa
acacctgagaaaatcttcttccaacttggaattgaagaagagaagctcaaaaactgggat
agtatcctatcatttggtgcaattcaacatgcgacggtacaaaaaggcgagcctttgttc
ccgcgtttagaggttgaagaagaagtagcctacattaaagaaaaaatgcagggaagtgca
cctaaggtagaagaagagaaagtggaaatcgaagaaacggaattacctgagctgggagca
gaaattgcatttgatgatttctcaaaagtcgatcttcgagttgcacaggtattggaagta
gccccagtgaagaaagcggatcgtctcttaaagcttcagcttgattttggatttgaaaaa
agacaaatagtctcagggattgccaagcactatcaaccagaggaattagtagggaaaaag
ctcgtttgcgtagcgaatcttacaccagttaaactcagaggggaaatttcccagggaatg
attttaactggggaaacaggcgggaaattgcaggttcttgaagtagatcaatctctagca
aatggaacaaaaattttataa

DBGET integrated database retrieval system