KEGG   Bacillus sp. WP8: QR42_12030Help
Entry
QR42_12030        CDS       T03530                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bacw  Bacillus sp. WP8
Pathway
bacw00071  Fatty acid degradation
bacw00072  Synthesis and degradation of ketone bodies
bacw00280  Valine, leucine and isoleucine degradation
bacw00310  Lysine degradation
bacw00362  Benzoate degradation
bacw00380  Tryptophan metabolism
bacw00620  Pyruvate metabolism
bacw00630  Glyoxylate and dicarboxylate metabolism
bacw00640  Propanoate metabolism
bacw00650  Butanoate metabolism
bacw00900  Terpenoid backbone biosynthesis
bacw01100  Metabolic pathways
bacw01110  Biosynthesis of secondary metabolites
bacw01120  Microbial metabolism in diverse environments
bacw01130  Biosynthesis of antibiotics
bacw01200  Carbon metabolism
bacw01212  Fatty acid metabolism
bacw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bacw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    QR42_12030
   00630 Glyoxylate and dicarboxylate metabolism
    QR42_12030
   00640 Propanoate metabolism
    QR42_12030
   00650 Butanoate metabolism
    QR42_12030
  09103 Lipid metabolism
   00071 Fatty acid degradation
    QR42_12030
   00072 Synthesis and degradation of ketone bodies
    QR42_12030
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    QR42_12030
   00310 Lysine degradation
    QR42_12030
   00380 Tryptophan metabolism
    QR42_12030
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    QR42_12030
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    QR42_12030
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    QR42_12030
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bacw04147]
    QR42_12030
Enzymes [BR:bacw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     QR42_12030
Exosome [BR:bacw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   QR42_12030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIZ60961
UniProt: A0A0B4SAF1
Position
complement(2384257..2385345)
Genome map
AA seq 362 aa AA seqDB search
MQAVIVQAKRTPFGDKNGMLKNYRPEQLAAPLIRHLSQDMTPDDVILGNVVGGGGNMARL
SSLEAGLPLHVPGMTIDRQCASGLEAIRIACIMVQSGEGSMYIAGGTESISRSPMKERAR
FSPEWIGDPHMGEAAELTASAFSVTRKEQDDYALLSWERSLAAFKHGTYAEEIVSVDGLS
IDQAAAKIRPMTKLIKRAKPVFLPGKGTVTAANSCKEADGAAAVAVMERSLAEASGCKAM
LRYAGSAVTAIHPHFPAASPIDAIKKLLHQENIKAEEVALFEINEAFALKAALIARTLGI
PYDRINRRGGALCLGHPYSASGAAMMVRLFYEAHTLPNGSYVMAAIGSGGGVGLAVLWQV
LS
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcggtgatcgtacaagcaaaacgaacacccttcggtgacaaaaatgggatgctg
aaaaattatcgcccagagcaattagccgctccccttattcggcatttgtcccaggacatg
acaccggatgacgtcatattaggcaatgtcgtcggaggcggtggaaatatggcccgtctg
tcctcattagaagcagggcttcctttacacgttcccggtatgacgattgacaggcaatgt
gcctctggtcttgaagcgatccgaatagcttgcatcatggttcaatcgggggagggctcg
atgtatatcgctggcgggactgagagcatttccagatcaccaatgaaagaaagagcccgc
ttttcaccggagtggataggagatccgcatatgggagaagcagcagagctgaccgcgtcg
gcattttctgttacaagaaaagaacaagatgactatgcccttttaagctgggaaagaagt
ttagcggcattcaaacatggtacatatgcagaagaaatcgtttcggttgacgggctgagc
atagatcaagcagctgctaaaataagaccgatgacaaagctgatcaagcgggcaaaacct
gtatttttgccggggaaaggaactgtgactgccgccaatagctgtaaggaagcagacgga
gcagctgctgtcgctgtgatggaaagatcgttagcggaagcaagtggatgtaaggcgatg
ctgcggtatgccggaagtgctgtgacagcgatacatcctcattttccagctgcttcaccg
attgatgcgatcaagaaacttttacatcaagagaacatcaaggcagaggaagtggcgctt
tttgaaatcaatgaagcatttgcgctgaaagcagcacttattgcccgcacgctggggata
ccatatgaccggatcaatagaagaggcggtgcactatgccttgggcatccatacagcgcg
tcaggagctgctatgatggtgagattattttatgaagcgcacaccttaccgaatggaagc
tatgtcatggctgctattggaagcggtggcggtgttggtttagccgttttgtggcaagtt
ttgtcatga

DBGET integrated database retrieval system