KEGG   Bacillus sp. WP8: QR42_12540Help
Entry
QR42_12540        CDS       T03530                                 

Definition
(GenBank) alanine-phosphoribitol ligase
  KO
K03367  D-alanine--poly(phosphoribitol) ligase subunit 1 [EC:6.1.1.13]
Organism
bacw  Bacillus sp. WP8
Pathway
bacw00473  D-Alanine metabolism
bacw01100  Metabolic pathways
bacw01503  Cationic antimicrobial peptide (CAMP) resistance
bacw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bacw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    QR42_12540
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    QR42_12540
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    QR42_12540
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:bacw01504]
    QR42_12540
Enzymes [BR:bacw01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     QR42_12540
Antimicrobial resistance genes [BR:bacw01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    QR42_12540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AIZ61056
UniProt: A0A0B4SAT2
Position
complement(2491869..2493374)
Genome map
AA seq 501 aa AA seqDB search
MKLLHTIHEYQQTKPTQPAFVSQQASITYDELWHLSDQMAGAIDAVAAGSEPVIVYGHME
PEMLISFLGSVKSGRPYIPVDISIPVERIVSIIESSKASLLICANEQNVLDVEEHIEVKS
AASLLALEKEAPPSTQWVQQDDVFYIIYTSGSTGKPKGVQVTANNLESFTEWMCRDFPIG
EGRTFLNQAPFSFDLSVMDLYPALQSGGTLYCLVKDLVNKPKDMFAALGQSDVEVWTSTP
SFVQMCLMDPSFTGELLPELKVFLFCGEALPVAVASALLERFPKAQVFNTYGPTEATVAI
TSIEVTQEILDQHDSLPVGYAKPDTDIVILDEEGKTLSDGEKGEIVIVGPSVTRGYLGEQ
ALTDKVFFEYEGRPAYRTGDAGVAQDGLITCHGRLDYQIKLHGYRMELEEIEYHVSETTY
VNACVIVPFQPNGHVEYLIAAIVPAAHSFEKEYQLTSAIKKEMADSLPAYMIPRKFVYLE
QLYMTPNGKVDRKRIAKEVLL
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaaactattacacacgattcatgaataccagcaaacgaaaccaacacagccagcattt
gtttctcaacaggcgtcgatcacatatgatgagctttggcatttatcagaccaaatggct
ggtgcgatcgatgcggtcgcagctggcagtgaacctgtcattgtctacggtcatatggag
ccagagatgctgatttctttcttaggcagtgtgaaatcaggcagaccttatattccggtc
gatatctcaatacctgttgagcgcatcgtctcaatcattgaaagctcaaaagccagtcta
ttgatatgtgcaaatgagcagaatgtattagatgtagaagagcacattgaagtgaaaagt
gcggcatcgcttttagcacttgaaaaagaagcaccgccatccacgcagtgggttcaacaa
gatgatgttttctacattatttatacgtctggcagtaccggaaaaccgaaaggcgttcag
gtaacagccaataatttagaaagctttacagagtggatgtgccgcgacttcccaattggt
gagggacgcacattcttaaatcaagcaccattttcttttgacttatcagtgatggatctc
tatccagcgcttcaatcaggcggcacgctttactgtttagtaaaagatcttgtcaataag
ccaaaggatatgtttgcagcacttggtcaatctgacgttgaagtgtggacatcaacacca
tcctttgtgcaaatgtgcttaatggacccttcctttacaggagagcttttaccagagctg
aaagttttcttgttctgcggtgaggcgcttcctgtagctgtagcaagtgcacttctggag
cgttttccaaaggcgcaggtctttaatacgtatggtccaactgaagcaactgttgcgatc
acatcgattgaagtcacgcaggagattcttgatcagcacgattctttaccagtcggctat
gccaaacctgatacagatatcgtcattttagatgaagaaggcaagacactttctgatggt
gagaaaggcgaaattgtcatcgtggggccaagcgtcacgagaggctacttaggtgaacaa
gccttaacggataaagtgttctttgaatacgaaggacgccctgcttaccgcacaggtgac
gcaggtgtggcgcaggatggattaattacgtgccacggtcgtctcgactatcaaattaag
cttcatggataccggatggagcttgaagaaattgaatatcatgtaagcgagacaacctat
gtcaatgcttgtgtgattgtgccattccagccaaacggtcatgtcgagtacttgattgca
gcgattgttccagcagctcattcatttgaaaaagagtatcagctgacaagtgcgattaag
aaagaaatggcggattcactgccagcgtacatgattccaagaaagtttgtctatcttgag
cagctttacatgacgccaaacgggaaggttgaccgtaagagaatcgcgaaagaggttctt
ctatga

DBGET integrated database retrieval system