KEGG   Bacillus sp. WP8: QR42_13905Help
Entry
QR42_13905        CDS       T03530                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K11440  choline dehydrogenase [EC:1.1.1.1]
Organism
bacw  Bacillus sp. WP8
Pathway
bacw00260  Glycine, serine and threonine metabolism
bacw01100  Metabolic pathways
Module
bacw_M00555  Betaine biosynthesis, choline => betaine
Brite
KEGG Orthology (KO) [BR:bacw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    QR42_13905
Enzymes [BR:bacw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     QR42_13905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 IF3_N ETF Hydrolase
Motif
Other DBs
NCBI-ProteinID: AIZ61290
UniProt: A0A0B4SAP9
Position
complement(2743874..2745082)
Genome map
AA seq 402 aa AA seqDB search
MTLNMKIESMQKFHTFEIPTVIKHGIGAVKHVGEEVKAYGVSKVLLVTDPGIYQAGVVDP
VIASLKEAQIDVVLFNKVEPNPPVRLVNEGSALYEKEGCNGLVAVGGGSSMDTAKAIGVE
ATHEGSVLDYEAAEGKKPLENRIPPLTTIPTTAGTGSEVTQWAVITDEEREFKFNTGGPL
IAAHLTVIDPELHVSMPPHVTAMTGIDALAHAIECYTMKFAQPITDAVALMAIEYAAHYI
RRAFADGEDLEARYGMAQAAMLAGLSYGSESAGAAHAMSQTLGGIIPVAHGQCVAAMMGP
VMEYNWKGYPEKFARIAQAFGVDTSRMTTEEAAKAAVNWMYDLVEDLEIPSLEEQGVSKD
MIDRLSKEAMKDPQTVGNPRDLNEKAYKWIYARCFELTPKTV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgacactaaatatgaaaattgaaagcatgcagaaattccatacatttgaaattccgact
gtcatcaaacacggcattggtgcagtgaaacatgttggggaagaagtaaaagcatacggc
gtttcaaaggtattgcttgtaacagaccccggcatttatcaagcgggcgtggtggacccc
gtcattgcttcattaaaagaagcgcaaattgatgttgttctatttaataaagtagagcca
aatccgccagtccgtctagtgaacgaaggatctgctttatatgaaaaagaaggctgtaat
ggattagtcgcagtaggcggcggcagctcaatggatacagccaaggcaattggagtagag
gcgactcatgaaggctcagttcttgattacgaagcggcagaggggaaaaaaccgcttgaa
aacagaatcccgcctttaaccactattccgacaacagctggtacaggttcagaagtgacg
caatgggcagtcattactgatgaagaaagagaattcaaattcaatacaggtggtcctctt
attgcagctcatcttacagtgattgacccagagcttcatgtatccatgccgcctcatgtg
acagcaatgactggaattgacgcgcttgctcacgcgattgaatgctatacgatgaaattt
gctcagccgattacagatgcggtagcactcatggccattgaatatgcagctcattatatt
cgccgtgcctttgctgatggtgaggacttggaagccagatatggaatggcacaagctgcg
atgcttgccgggctttcttatggaagtgaatcagctggcgctgcacatgcgatgagccaa
acactcggaggcattattcctgtcgcgcacggtcagtgtgttgcagcgatgatgggacca
gtgatggaatataactggaaagggtatccggaaaaattcgcacgaattgcgcaagcgttt
ggggttgatacaagcagaatgacaacagaggaagcagccaaagcagccgtgaactggatg
tatgatttagtagaagatttagaaattccttcattagaagaacaaggtgtatcaaaagat
atgattgaccgtttatctaaagaagcgatgaaagatccgcaaacagttggaaacccaaga
gatctaaacgaaaaagcgtacaaatggatttatgcgcgctgctttgagttaacacctaaa
acagtgtaa

DBGET integrated database retrieval system