KEGG   Bacillus sp. YP1: QF06_01075Help
Entry
QF06_01075        CDS       T03701                                 

Definition
(GenBank) sugar isomerase
  KO
K09988  D-lyxose ketol-isomerase [EC:5.3.1.15]
Organism
bacy  Bacillus sp. YP1
Pathway
bacy00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:bacy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    QF06_01075
Enzymes [BR:bacy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.15  D-lyxose ketol-isomerase
     QF06_01075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_2 Lyx_isomer ARD
Motif
Other DBs
NCBI-ProteinID: AJO57118
Position
243304..243807
Genome map
AA seq 167 aa AA seqDB search
MGITKEEVNSYYQKAGIVLTDEEVDQIQLMDYGLGKERKVGLQLFVYVNTDRYCSKELVL
FPGQTCPEHRHPPVDGQEGKQETFRCRYGKVYLYVEGEKTPLPKVLPPQEDREHYTVWHE
IELEPGGQYTIPPNTKHWFQAGEEGAVVTEMSSTSTDKHDIFTDPRI
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgggcatcacgaaagaagaagtgaacagctactatcaaaaagcagggattgtattaacg
gacgaggaagtagaccaaatccagctgatggattacggcttaggaaaagaaagaaaagtc
gggctccagctcttcgtctacgtcaatacagaccgttattgctcaaaggaattggtgctg
tttccgggacagacttgcccggaacaccgccatccgccggtcgacggccaggaaggcaag
caggagaccttccgctgccgctacggaaaagtgtatctttacgtagaaggagaaaaaacg
ccgcttccaaaagttctccctcctcaggaagacagagaacactatacggtctggcacgaa
attgagctagaaccgggcgggcaatacacgattccaccaaacacaaagcattggttccag
gctggggaagaaggtgctgtcgtgacggaaatgtcatcgacgagcacggataaacatgat
atctttaccgatccaagaatataa

DBGET integrated database retrieval system