KEGG   Bacillus sp. YP1: QF06_02030Help
Entry
QF06_02030        CDS       T03701                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bacy  Bacillus sp. YP1
Pathway
bacy00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bacy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    QF06_02030
Enzymes [BR:bacy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     QF06_02030
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     QF06_02030
    1.1.1.-  
     QF06_02030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N 2-Hacid_dh_C F420_oxidored
Motif
Other DBs
NCBI-ProteinID: AJO57286
Position
complement(423984..425024)
Genome map
AA seq 346 aa AA seqDB search
MKAARWHNQKDIRIEHIEEPKTEPGKVKIKVKWCGICGSDLHEYLGGPIFIPVDKPHPLT
NETAPVTMGHEFSGEVVEVGEGVENYKVGDRVVVEPIFATHGHQGAYNLDEQMGFLGLAG
GGGGFSEYVSVDEELLFKLPDELSYEQGALVEPSAVALYAVRSSKLKAGDKAAVFGCGPI
GLLVIEALKAAGATDIYAVELSPERQQKAEELGAIIVDPSKTDDVVAEIAERTGGGVDVA
FEVTGVPVVLRQAIQSTTIAGETVIVSIWEKGAEIHPNDIVIKERTVKGIIGYRDIFPAV
LSLMKEGYFSADKLVTKKIVLDDLIEEGFGALIKEKSQVKILVRPN
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagcaagatggcataaccaaaaggatatccgtattgaacatatcgaagagcca
aaaacggagccgggaaaagtaaagatcaaagtcaaatggtgcggcatctgcggaagtgat
ttacacgaatatctgggcggcccgatctttattccggttgacaaaccgcatccattaaca
aatgaaacggcacctgtcacaatggggcatgaattctccggtgaagttgtcgaagtcgga
gaaggcgttgaaaattataaagttggagaccgcgtcgtagtcgagccgatttttgctaca
cacggccaccaaggcgcctacaaccttgatgaacaaatgggattcctcggcttagccggc
ggaggcggcggtttctctgaatacgtctctgtagatgaagagcttttgttcaaacttcct
gatgaattatcatatgaacaaggcgcgctcgttgaaccttctgcagttgctctatacgct
gtccgctcaagcaaactcaaagcaggcgacaaagcggctgtattcggctgcggcccgatc
ggacttcttgtcattgaagcgctgaaggctgccggtgcaactgatatttacgctgttgag
ctttctcctgaacgccagcaaaaagctgaggagcttggcgcgatcatcgttgatccgtct
aaaacagacgatgtagtcgctgagattgcagaacgtacaggaggcggtgttgacgtagca
ttcgaagtcacgggtgtcccagtggtgttacgacaagccatccagtccactacaattgcc
ggtgaaaccgtcatcgtcagcatttgggaaaaaggtgctgaaatccatccgaacgatatc
gtaatcaaagaacgtacagtaaaaggaattatcggataccgcgacatcttcccggctgta
ttgtcattaatgaaagaaggctatttctcagccgacaaactcgtaacgaaaaaaatcgta
ctagatgatttgatcgaggaaggcttcggggctcttattaaagagaaaagccaagtcaaa
atccttgtcagacctaactaa

DBGET integrated database retrieval system