KEGG   Bacillus sp. YP1: QF06_10275Help
Entry
QF06_10275        CDS       T03701                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bacy  Bacillus sp. YP1
Pathway
bacy00071  Fatty acid degradation
bacy00072  Synthesis and degradation of ketone bodies
bacy00280  Valine, leucine and isoleucine degradation
bacy00310  Lysine degradation
bacy00362  Benzoate degradation
bacy00380  Tryptophan metabolism
bacy00620  Pyruvate metabolism
bacy00630  Glyoxylate and dicarboxylate metabolism
bacy00640  Propanoate metabolism
bacy00650  Butanoate metabolism
bacy00900  Terpenoid backbone biosynthesis
bacy01100  Metabolic pathways
bacy01110  Biosynthesis of secondary metabolites
bacy01120  Microbial metabolism in diverse environments
bacy01130  Biosynthesis of antibiotics
bacy01200  Carbon metabolism
bacy01212  Fatty acid metabolism
bacy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bacy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    QF06_10275
   00630 Glyoxylate and dicarboxylate metabolism
    QF06_10275
   00640 Propanoate metabolism
    QF06_10275
   00650 Butanoate metabolism
    QF06_10275
  09103 Lipid metabolism
   00071 Fatty acid degradation
    QF06_10275
   00072 Synthesis and degradation of ketone bodies
    QF06_10275
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    QF06_10275
   00310 Lysine degradation
    QF06_10275
   00380 Tryptophan metabolism
    QF06_10275
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    QF06_10275
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    QF06_10275
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    QF06_10275
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bacy04147]
    QF06_10275
Enzymes [BR:bacy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     QF06_10275
Exosome [BR:bacy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   QF06_10275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AJO58832
Position
complement(2119496..2120677)
Genome map
AA seq 393 aa AA seqDB search
MRKTVIVSAARTPFGKFGGVLKEVKAAELGGIVMKEALQRAGVSGDDVEGNVMGMVVQAG
SGQIPSRQAARLAGMPWSVPSETLNKVCASGLRAVTLCDQMIRAQDANILVAGGMESMSN
IPYAVPAGRWGARMGDGELRDLMVYDGLTCAFDEVHMAVHGNIAAMEYAISRREQDEWAL
RSHARAAKAADEGKFQDEIVPVNWIGRKGKPNVVDKDEAIRRDTSLDQLAKLAPIYASDG
SITAGNAPGVNDGAGAFVLMSEEKAAELGKRPLATILGFSTTGMPAHELAAAPGFAINKL
LKKNGLTVQDIDLFEVNEAFASVVLTCEKIVGFDLEKVNVNGGAIALGHPIGASGARILM
TLVYELKRRGGGLGVAAICSGAAQGDAVLVQVH
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaaacagtcattgtaagtgctgcaagaactccatttggcaaattcggcggagtt
ttgaaagaggtgaaagctgctgagcttgggggcattgtgatgaaggaggcgctgcaacgg
gctggagtctctggagatgatgtagaaggaaacgtcatgggcatggttgtccaggccggc
tcagggcagataccttcccgtcaagctgcccgtctggcgggaatgccttggagtgtgccg
tcagaaacactgaataaagtctgtgcttccggccttcgtgctgtcactttatgtgatcaa
atgattcgggcgcaggatgcgaacatacttgttgcggggggaatggaaagcatgagcaat
attccgtatgccgttcccgccgggcgctggggagcacggatgggggacggcgagcttagg
gacttaatggtgtatgacggattaacgtgcgcatttgacgaggtgcacatggctgttcac
ggaaatatagctgccatggaatatgcaatctcacgaagagagcaggacgaatgggcgttg
agaagtcatgcaagggcagctaaggccgccgatgaagggaagtttcaggatgaaattgtt
cctgtcaactggatcggtcgaaaaggaaaaccaaacgttgttgataaagatgaagcgatt
cgccgtgacacaagtctggatcagctcgcgaaacttgctcctatttatgcaagtgacggt
tctatcacagccggcaatgctcctggagtcaatgacggagccggcgcgttcgtgctgatg
tctgaggaaaaagctgctgagcttggcaaacggcctctggctacaattcttggtttttca
actacgggaatgccagcgcacgagctggcggcagcgccgggatttgccattaacaagctc
ctgaaaaagaacggtttaactgtccaagatattgacttgtttgaagtaaatgaagctttt
gcttcagttgttttgacatgtgaaaaaatcgtaggtttcgatcttgaaaaagtaaatgta
aatggcggtgcgatcgcgctcggccatccgatcggcgcgagcggggcgagaattctcatg
acgcttgtttatgaattaaagcggcggggaggggggctgggcgttgccgctatttgcagc
ggggcagcacagggagacgccgtcttagtgcaggttcattaa

DBGET integrated database retrieval system