KEGG   Bacillus sp. YP1: QF06_17075Help
Entry
QF06_17075        CDS       T03701                                 

Gene name
argS
Definition
(GenBank) arginine--tRNA ligase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
bacy  Bacillus sp. YP1
Pathway
bacy00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bacy00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    QF06_17075 (argS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bacy01007]
    QF06_17075 (argS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bacy03016]
    QF06_17075 (argS)
   03029 Mitochondrial biogenesis [BR:bacy03029]
    QF06_17075 (argS)
Enzymes [BR:bacy01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     QF06_17075 (argS)
Amino acid related enzymes [BR:bacy01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   QF06_17075 (argS)
Transfer RNA biogenesis [BR:bacy03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    QF06_17075 (argS)
 Prokaryotic Type
   Other AARSs
    QF06_17075 (argS)
Mitochondrial biogenesis [BR:bacy03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    QF06_17075 (argS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DALR_1 Arg_tRNA_synt_N tRNA-synt_1d tRNA-synt_1g tRNA-synt_1e tRNA-synt_1f tRNA-synt_1
Motif
Other DBs
NCBI-ProteinID: AJO60098
Position
complement(3469993..3471663)
Genome map
AA seq 556 aa AA seqDB search
MNIAEQMKDVLKEEIKAAVLKAGLAEESQIPNVVLETPKDKTHGDYSTNMAMQLARVAKK
APRQIAEEIVAHFDKGKASIEKLDIAGPGFINFYMNNQYLTKLIPSVLEAGEAYGETNIG
NGERVQVEFVSANPTGDLHLGHARGAAVGDSLCNVLSKAGYDVSREYYINDAGNQINNLA
LSVEVRYFEALGLEKPMPEDGYRGEDIIAIGKRLAEEYGDRFVNEEESERLAFFREYGLK
YELDKLRKDLENFRVPFDVWYSETSLYQNGKIDTALEALREKGHVYEEDGATWFRSTTFG
DDKDRVLIKKDGTYTYLLPDIAYHKDKLDRGFDKLINVWGADHHGYIPRMKAAIEALGYE
KGTLEVEIIQLVHLYKNGEKMKMSKRTGKAVTMRDLIEEVGLDAVRYFFAMRSADTHMDF
DLDLAVSTSNENPVYYAQYAHARICSMLRQGEEQGLKPAADLDFSHIQSEKEYDLLKTIG
GFPEAVAEAAEKRIPHRVTNYIYDLASALHSFYNAEKVIDPENEEKSRARLALMKATQIT
LNNALQLIGVSAPEKM
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgaacattgcggaacaaatgaaggacgtgctgaaagaagaaatcaaagcggccgttctg
aaagcgggactggctgaagaaagccagattcccaatgttgttttagaaacaccgaaagat
aaaacacacggcgactactcaacgaatatggcgatgcagttggcaagagtggcaaaaaaa
gcgccgcgtcaaatcgctgaagagattgtcgctcattttgataaaggaaaggcttcgatt
gaaaaactggatatcgccggcccgggttttatcaatttctatatgaacaatcaatattta
acaaagctgattccgtctgtactggaagcaggggaagcatacggggaaacgaacatcgga
aacggtgaacgagttcaggtagaattcgtatcagcgaatccgacgggagaccttcacctc
gggcatgcgcgcggggcggctgtcggcgattccttgtgcaacgtgctttcaaaagcgggt
tacgatgtaagccgcgaatactacattaacgatgcgggaaaccaaatcaacaatctggcg
ctttctgttgaagtccgttactttgaagcgctcggattggaaaaaccgatgccggaggat
ggctaccgcggcgaggatatcattgcgatcggaaagcgtctcgctgaggaatacggtgac
cgtttcgttaacgaagaggaaagtgaacgcctcgcgtttttccgtgaatacggcctgaaa
tacgagctggacaagcttcgcaaggacttggaaaacttccgtgtgccgtttgatgtgtgg
tattccgaaacttcactgtaccaaaatggaaaaatcgacacggcgcttgaagcgctccgc
gaaaaaggccatgtctatgaagaagacggcgcgacttggttccgttccacgacgttcggc
gatgataaagaccgcgtattgatcaagaaggacggcacgtacacgtacctgcttcctgat
atcgcgtatcataaggacaagcttgaccgcggctttgataagctgatcaacgtttggggc
gccgatcaccacggctacatcccgcgtatgaaagcggcaatcgaagcgctggggtatgaa
aaaggaacgcttgaagtagaaatcattcagctcgttcacctttacaaaaacggcgagaaa
atgaaaatgagcaaacggaccggtaaagccgtaacgatgcgtgacctgattgaagaagtc
ggcttggatgccgtgcgttacttctttgcaatgcgaagtgcagacacccatatggatttt
gacttagatcttgctgtatcaacatctaacgaaaaccctgtgtattatgcacaatacgcg
catgcacgtatttgcagcatgcttcgccaaggggaagagcaggggcttaaaccggcggca
gatcttgatttcagccatattcaatcagaaaaagaatacgatctgctgaaaacgatcggc
ggcttcccagaggcagtggcggaagcagcggaaaaacgaattccgcaccgtgtcactaac
tatatttatgatctggcttctgctctgcacagcttctacaacgcagagaaagtcatcgac
cctgaaaatgaagagaaaagccgcgcgcgcctggctttaatgaaggcaacgcaaattacg
ctgaacaatgcgcttcagctgatcggcgtatcggctccggaaaaaatgtaa

DBGET integrated database retrieval system