KEGG   Bacillus sp. YP1: QF06_19195Help
Entry
QF06_19195        CDS       T03701                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bacy  Bacillus sp. YP1
Pathway
bacy00450  Selenocompound metabolism
bacy00970  Aminoacyl-tRNA biosynthesis
bacy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bacy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    QF06_19195
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    QF06_19195
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bacy01007]
    QF06_19195
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bacy03016]
    QF06_19195
Enzymes [BR:bacy01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     QF06_19195
Amino acid related enzymes [BR:bacy01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   QF06_19195
Transfer RNA biogenesis [BR:bacy03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    QF06_19195
 Prokaryotic type
   Other AARSs
    QF06_19195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f ARL2_Bind_BART
Motif
Other DBs
NCBI-ProteinID: AJO60496
Position
3894315..3896309
Genome map
AA seq 664 aa AA seqDB search
MPQENNTFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRLKGFDVRYLTGTDEHGQKIQ
QKAEQENITPQEYVDRAAADIQKLWKQLEISNDDFIRTTEKRHKVVIEKVFQKLLDNGDI
YLDEYEGWYSIPDETFYTETQLVDIERNEKGEVIGGKSPDSGHPVELIKEESYFFRMGKY
ADRLLKYYEENPTFIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGVKVPENPKHVVYVW
IDALFNYLTALGYDTENDELYQKYWPADVHLVGKEIVRFHTIYWPIMLMALDLPLPKQVF
AHGWLLMKDGKMSKSKGNVVDPVTLIERYGLDELRYYLLREVPFGSDGVFTPEGFVERIN
YDLANDLGNLLNRTVAMINKYFDGQIGSYKGAVTEFDHTLTSVAEETVKAYEKAMENMEF
SVALSTLWQLISRTNKYIDETAPWVLAKDPAKEEELRSVMYHLAESLRISAVLLQPFLTK
TPEKMFEQLGITDESLKAWDSITAFGQLKDTKVQKGEPLFPRLEAEEEIAYIKGKMQGSA
PAKEETKEEEPQEVDRLPEITIDQFMDVELRVAEVIEAEPVKKADRLLKLQLDLGFEKRQ
VVSGIAKHYTPEELVGKKLVCVTNLKPVKLRGELSQGMILAGEADGVLKVVSIDQSLPKG
TRIK
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaagaaaacaatacattttacattacaacaccgatttattatccgagcggaaaa
ttacatatcggccatgcatatacgacagtcgcgggagatgcaatggcacgttacaaaaga
ttaaaagggttcgatgttcgctatttaacgggaacggacgagcatggacaaaagatccag
caaaaagctgaacaggaaaacattacacctcaggagtatgtggatcgcgcagcggcagat
attcaaaaactgtggaagcagcttgaaatctcaaacgacgactttatccgcacgacagaa
aaacggcataaagttgtcattgaaaaagtgtttcaaaagcttcttgataacggggacatc
tatcttgatgagtatgaaggctggtacagcatccctgatgaaacgttctacacggaaact
cagctcgttgatattgagcggaatgaaaagggagaggtcatcggcggaaaaagccctgac
agcggtcacccagttgaattgatcaaagaggaatcttatttcttccgcatggggaaatac
gcggatcgtcttctgaaatactatgaagaaaacccgacattcattcagccagaatcacgc
aaaaacgaaatgattaataactttatcaaacctggacttgaggatttggcagtatcacgt
accacttttgattggggcgtgaaggtgccggaaaatccaaagcatgttgtatatgtttgg
attgacgcactatttaactatttaacggcactcggttatgatacagaaaatgatgagctt
tatcaaaaatattggcctgccgatgttcatttagtcggtaaggagattgtacgattccat
actatttactggccaattatgctgatggcgctggatcttccgctgccaaagcaagtattc
gcgcatggctggcttttgatgaaagacggaaaaatgtcgaaatcaaaaggaaacgttgta
gatccggttacattaattgaacgctatggtttagacgaacttcgctattacttgcttcgc
gaagtgccgttcggatcagacggtgttttcacgccggaaggatttgttgagcgaatcaac
tatgatttagcgaatgatttaggaaatctattgaatcgtactgttgcgatgattaataag
tattttgacggacaaatcggttcttacaaaggtgctgttacggaatttgaccatacgctc
acttctgttgctgaagaaacagtgaaagcttatgagaaagcaatggaaaatatggagttc
tcggtagcactttcgactttatggcagctcatcagccgcacaaacaaatacattgatgag
acagctccatgggtgcttgcgaaagatccggcaaaagaagaagaattgcgatcagttatg
tatcatctcgctgaatcattgcgtatttcagcggtactgcttcagccattcttaacaaaa
acacctgaaaaaatgttcgagcagctgggcattactgatgaatctttaaaagcttgggac
agcattacagctttcggccagctgaaagatacaaaagtacaaaaaggcgagccattgttc
cctcgtttagaggcagaagaagaaattgcttacatcaaagggaaaatgcaaggttcagca
ccagcgaaagaagaaacaaaagaagaagagcctcaagaggtcgatcgtttacctgaaatt
acgattgatcaatttatggatgtagagcttcgcgtagctgaggtcattgaggcagagcca
gtgaaaaaagcagaccgtttattgaagctgcagcttgatcttggttttgaaaagcgccaa
gtggtatccggcattgcgaagcattatacgcctgaagagcttgttggaaaaaaactcgtt
tgtgtaacaaatctaaaaccggttaaactcagaggagagctttctcaaggtatgatcctt
gcaggagaagcagacggcgttttaaaggtcgtgtctatcgatcagtcgttaccaaaaggc
acaagaattaaataa

DBGET integrated database retrieval system