KEGG   Bifidobacterium adolescentis ATCC 15703: BAD_0992
Entry
BAD_0992          CDS       T00437                                 

Symbol
pfl
Name
(GenBank) formate acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
bad  Bifidobacterium adolescentis ATCC 15703
Pathway
bad00620  Pyruvate metabolism
bad00640  Propanoate metabolism
bad00650  Butanoate metabolism
bad01100  Metabolic pathways
bad01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BAD_0992 (pfl)
   00640 Propanoate metabolism
    BAD_0992 (pfl)
   00650 Butanoate metabolism
    BAD_0992 (pfl)
Enzymes [BR:bad01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     BAD_0992 (pfl)
SSDB
Motif
Pfam: PFL-like Gly_radical
Other DBs
NCBI-ProteinID: BAF39773
UniProt: A1A240
Position
complement(1228494..1230869)
AA seq 791 aa
MAAVDATAVSQEELEAKAWEGFTEGNWQKDIDVRDFIQKNYTPYEGDESFLADATDKTKH
LWKYLDDNYLSVERKQRVYDVDTHTPAGIDAFPAGYIDSPEVDNVIVGLQTDVPCKRAMM
PNGGWRMVEQAIKEAGKEPDPEIKKIFTKYRKTHNDGVFGVYTKQIKVARHNKILTGLPD
AYGRGRIIGDYRRVALYGVNALIKFKQRDKDSIPYRNDFTEPEIEHWIRFREEHDEQIKA
LKQLINLGNEYGLDLSRPAQTAQEAVQWTYMGYLASVKSQDGAAMSFGRVSTFFDVYFER
DLKAGKITETDAQEIIDNLVMKLRIVRFLRTKDYDAIFSGDPYWATWSDAGFGDDGRTMV
TKTSFRLLNTLTLEHLGPGPEPNITIFWDPKLPEAYKRFCARISIDTSAIQYESDKEIRS
HWGDDAAIACCVSPMRVGKQMQFFAARVNSAKALLYAINGGRDEMTGMQVIDKGVIDPIK
PEADGTLDYEKVKANYEKALEWLSETYVMALNIIHYMHDKYAYESIEMALHDKEVYRTLG
CGMSGLSIAADSLSACKYAKVYPIYNKDAKTTPGHENEYVEGADDDLIVGYRTEGDFPLY
GNDDDRADDIAKWVVSTVMGQVKRLPVYRDAVPTQSILTITSNVEYGKATGAFPSGHKKG
TPYAPGANPENGMDSHGMLPSMFSVGKIDYNDALDGISLTNTITPDGLGRDEEERIGNLV
GILDAGNGHGLYHANINVLRKEQLEDAVEHPEKYPHLTVRVSGYAVNFVKLTKEQQLDVI
SRTFHQGAVVD
NT seq 2376 nt   +upstreamnt  +downstreamnt
atggcagcagttgatgcaacggcggtctcccaggaggaacttgaggctaaggcttgggaa
ggcttcaccgagggcaactggcagaaggacattgatgtccgcgacttcatccagaagaac
tacacgccatatgagggcgacgagtccttcctggctgacgccaccgacaagaccaagcac
ctgtggaagtatctggacgacaactatctgtccgtggagcgcaagcagcgcgtctacgac
gtggacacccacaccccggcgggcatcgacgccttcccggccggctacatcgattccccg
gaagtcgacaatgtgattgtcggtctgcagaccgatgtgccgtgcaagcgcgccatgatg
ccgaacggcggctggcgtatggtcgagcaggccatcaaggaagccggcaaggagcccgat
ccggagatcaagaagatcttcaccaagtaccgcaagacccacaacgacggcgtcttcggc
gtctacaccaagcagatcaaggtagctcgccacaacaagatcctcaccggcctgccggat
gcctacggccgtggccgcatcatcggcgattaccgtcgtgtggccctgtacggcgtgaac
gcgctgatcaagttcaagcagcgcgacaaggactccatcccgtaccgcaacgacttcacc
gagccggagatcgagcactggatccgcttccgtgaggagcatgacgagcagatcaaggcc
ctgaagcagctgatcaacctcggcaacgagtacggcctcgacctgtcccgcccggcacag
accgcacaggaagccgtgcagtggacctacatgggctacctcgcctccgtcaagagccag
gacggcgccgccatgtccttcggccgtgtctccaccttcttcgacgtctacttcgagcgc
gacctgaaggccggcaagatcaccgagaccgacgcacaggagatcatcgataacctggtc
atgaagctgcgcatcgtgcgcttcctgcgcaccaaggattacgacgcgatcttctccggc
gatccgtactgggcgacttggtccgacgccggcttcggcgacgacggccgtaccatggtc
accaagacctcgttccgtctgctcaacaccctgaccctcgagcacctcggacctggcccg
gagccgaacatcaccatcttctgggatccgaagctgccggaagcctacaagcgcttctgc
gcccgaatctccatcgacacctcggccatccagtacgagtccgataaggaaatccgctcc
cactggggcgacgacgccgccatcgcatgctgcgtctccccgatgcgcgtgggcaagcag
atgcagttcttcgccgcccgtgtgaactccgccaaggccctgctgtacgccatcaacggc
ggacgcgacgagatgaccggcatgcaggtcatcgacaagggcgtcatcgacccgatcaag
ccggaagccgatggcacgctggattacgagaaggtcaaggccaactacgagaaggccctc
gaatggctgtccgagacctatgtgatggctctgaacatcatccattacatgcatgataag
tacgcttacgagtccatcgagatggctctgcacgacaaggaagtgtaccgcaccctcggc
tgcggcatgtccggcctgtcgatcgcggccgactccctgtccgcatgcaagtacgccaag
gtctacccgatctacaacaaggacgccaagaccacgccgggccacgagaacgagtacgtc
gaaggcgccgatgacgatctgatcgtcggctaccgcaccgaaggcgacttcccgctgtac
ggcaacgatgatgaccgtgccgacgacatcgccaagtgggtcgtctccaccgtcatgggc
caggtcaagcgtctgccggtgtaccgcgacgccgtcccgacccagtccatcctgaccatc
acctccaatgtggaatacggcaaggccaccggcgccttcccgtccggccacaagaagggc
accccgtacgctccgggcgccaacccggagaacggcatggactcccacggcatgctgccg
tccatgttctccgtcggcaagatcgactacaacgacgctcttgacggcatctcgctgacc
aacaccatcacccctgatggtctgggccgcgacgaggaagagcgtatcggcaacctcgtt
ggcatcctggacgccggcaacggccacggcctgtaccacgccaacatcaacgtgctgcgc
aaggagcagctcgaggatgccgtcgagcatccggagaagtacccgcacctgaccgtgcgc
gtctccggctacgcggtgaacttcgtcaagctcaccaaggaacagcagctcgacgtgatc
tcccgtacgttccaccagggcgctgtcgtcgactga

DBGET integrated database retrieval system