KEGG   Bifidobacterium adolescentis ATCC 15703: BAD_0903Help
Entry
BAD_0903          CDS       T00437                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bad  Bifidobacterium adolescentis ATCC 15703
Pathway
bad00260  Glycine, serine and threonine metabolism
bad00750  Vitamin B6 metabolism
bad01100  Metabolic pathways
bad01110  Biosynthesis of secondary metabolites
bad01120  Microbial metabolism in diverse environments
bad01230  Biosynthesis of amino acids
Module
bad_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bad00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAD_0903 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BAD_0903 (thrC)
Enzymes [BR:bad01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BAD_0903 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: BAF39684
UniProt: A1A1V1
Position
1122750..1124237
Genome map
AA seq 495 aa AA seqDB search
MTTFHSTRSTTDSLTSKQAIRKGIADDGGLFVTDSLGETHVDIASLAGKSYQQIAFDVLS
VLLPDYTEAELKECIDEAYGPQWSDEKITPVKPLGDDYVMELFNGPTSAFKDVALQILPR
FMARTTPADGDADEKIMIVTATSGDTGKAALAGFADAAGTGITVFYPEGKVSQVQELQMT
TQSGSNVNVCAVKGNFDDAQSAVKRIFGDKELAGRLADDSHVVLSSANSINVGRLVPQVV
YYFSAYAQLLERQVINVGDEVEFVVPTGNFGDILAGYYAKLLGLPVKHLVVASDKNNVLF
DFLTSGTYNRQRPFFQTISPSMDILISSNLERMLYYMSDKDTRLISMLMNDLSQWGAYEV
PEPMMKKIRSIFGTGWADENQVREMIADCWNKNHYVIDPHTACGYYVMQQMPRDPLTPRV
LLSTASPYKFPRVVNESLGLDASGTDFECMDVLAKATGTTAPAALRGLETANVRFDNVVE
IDGMEGFVEQAAKAL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacgttccacagcacacgcagcaccaccgattcgcttacctccaagcaggccatc
cgcaagggcatcgccgatgatggcggcctgttcgtgaccgactccttgggtgagacccat
gtggatatcgcttccttggccggcaagtcctaccagcagatcgcgttcgatgtgctgtcc
gtgctgctgccggactacaccgaggccgagctcaaggagtgcatcgacgaggcgtacggc
ccgcagtggtccgacgagaagatcactccggtcaagccgctcggcgatgactatgtgatg
gaactgttcaacggtccgacttccgcgttcaaagatgtggcgctgcagattctgccgcgt
ttcatggcgcgcaccactccggcggatggcgacgcggatgagaagatcatgatcgtcacc
gccacgtccggcgacaccggcaaggccgcgttggctggtttcgcggacgccgcgggcacc
ggcatcaccgtgttctatccggaaggcaaggtcagccaggtgcaggagctgcagatgacc
acgcagtccggctccaatgtgaacgtgtgcgcggtcaagggcaatttcgatgacgcgcag
tccgccgtcaagcgcatcttcggcgacaaggagcttgccggacgtctcgccgatgattcg
catgtggtgctttcctccgcgaattccatcaatgtgggccgtctggtgccgcaggtcgtc
tattacttctccgcgtacgcgcagctgctggaacgccaggtcatcaatgtgggcgacgag
gtcgagttcgttgtgccgacgggtaatttcggcgacatcctcgccggctattacgcgaaa
ctgctgggcctgccggtcaagcatcttgtggtggcgtccgacaagaacaacgtgctgttc
gacttcctgacttccggcacgtacaaccgtcagcgtccgttcttccagaccatttccccg
tcgatggatatcctcatctcatcgaacctggagcgcatgctgtattacatgtccgacaag
gacacacgcctgatctccatgctgatgaacgatctgagccagtggggcgcctacgaggtt
cccgagccgatgatgaagaagattcgttccatcttcggcaccggttgggccgatgagaac
caggtgcgcgagatgatcgcggactgctggaacaagaaccattacgtgatcgacccgcac
accgcatgcggctactacgtcatgcagcagatgccgcgcgatccgctcacgccgcgcgtg
ctgctgtccaccgccagcccgtacaagttcccgcgcgtagtcaacgaatctctgggtctt
gacgcgtccggcaccgatttcgaatgcatggacgtgcttgccaaggccaccggcaccacc
gctccggccgcgctgcgcggtcttgagaccgccaacgtgcgtttcgataacgtcgtcgaa
atcgacggcatggaaggattcgtcgagcaggccgcgaaggcgctgtaa

DBGET integrated database retrieval system