KEGG   Bifidobacterium adolescentis ATCC 15703: BAD_1560Help
Entry
BAD_1560          CDS       T00437                                 

Gene name
malQ
Definition
(GenBank) 4-alpha-glucanotransferase
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bad  Bifidobacterium adolescentis ATCC 15703
Pathway
bad00500  Starch and sucrose metabolism
bad01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bad00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BAD_1560 (malQ)
Enzymes [BR:bad01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     BAD_1560 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_77
Motif
Other DBs
NCBI-ProteinID: BAF40341
UniProt: A1A3Q8
Position
1971927..1974095
Genome map
AA seq 722 aa AA seqDB search
MTQTQQTESAERIARPLIQLAKLNGISTSYIDQLGTYVEIRDEVLVSVLAALGVDASSDE
AITASYAATQQRIADTLVEPTVVKFIGKEAVTPIRAKGNDVALKLTLEDGTEYAGDLTAY
LTGSNADDGSLQLTLPDDIPAGYHTLAVDAGPLHAEAALICAPARIELPPAVAEKQRWGW
MAQMYSIRSAESWGVGDYGDLKLLLSDAATKSHADFMLINPIHATAPVPPLEPSPYLPES
RRFLNVTYIRPQDIAEYAELNEADQAEVARLHAEVSPANDSIEPLDINSAWWHKRQALQL
VYNVPRSVERQAAFDAFKEAAGPDLRAFAAWSVAFQVWGAPWEGTWFKDTNRDSPEVVEL
MREHADMVDFECWLQWIADEQVTAAQNAARDSGMALGLMQDMAVGVHSLGADVWWNPERF
AVGSVTVGCPPDFYNQQGQDWGQPPFNPNYLAKTGYGVYREMVHNMFSHAGAVRIDHILG
LFRLWWIPQGEGARGGAYVTYDYEAMIAILTIEASRVNGLVVGEDLGTVPDYVRTVLGEH
GLLGCMVEWFARVDDSPNAGDPYADPSTYRKYALASVTTHDLPPTAGYLQFEHVKLREQL
HLLSGPVEEFQASATAERDAMMDRLVESGLITPEVAGDVEGHIQEIVEAMHKMLLKSPSV
LLQAALVDGVGETRTQNQPGTSSEYSNWRVPLAGPDLKVVHTDEVFDLPRVQSLAAIMNG
EK
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgacacagacccagcagaccgaaagcgcagaacgcatcgcacggcctcttatccagctc
gccaagctcaatggcatttccacgtcgtatatcgaccagctcggcacctatgtggaaatc
cgcgacgaagtgctcgtctccgtattggccgcactcggtgtggacgcatccagcgacgaa
gcgatcaccgcctcctatgcggcgacccagcagcgcatcgcagacacacttgttgagccg
accgtcgtgaagttcatcggcaaggaagccgtcacgccaatccgcgcgaaaggaaacgac
gtggcgctgaagctgacgttggaagacggcacggaatatgcgggcgatctgaccgcgtat
ctgacgggctcgaacgcagatgacggctcgctgcaactgacgctgccggacgatattccc
gccggctaccacacgctggccgtcgatgccggcccgctgcacgccgaagccgcgctgatc
tgcgcaccggcacgcatcgaactgccgccagcagtagcggaaaagcaacgttggggctgg
atggcacagatgtattccatccgttccgctgaatcctggggcgtgggcgactatggcgat
ctgaagctgctgctgtccgacgcggcaacgaaatcgcatgccgatttcatgcttatcaac
ccgattcacgccaccgcgccggtgccgccgctggagccgtcgccatatcttcccgaatcg
cgtcgttttctcaatgtgacgtacatccgtccgcaggatatcgctgaatatgcggaactc
aacgaggcggaccaggccgaagtggcgcgtctgcacgcggaagtctcgccagccaacgac
agtatcgagccgctcgacatcaattccgcttggtggcacaagcgccaggcgctgcagctt
gtgtacaacgtgccgcgttccgtcgagcgtcaggccgcgttcgacgcgttcaaggaggcc
gcgggtccggatctgcgcgcgttcgccgcatggtcggtggcgttccaggtgtggggcgcg
ccgtgggaaggcacgtggttcaaggacacgaaccgcgattcgcctgaagtggtggagctc
atgcgcgagcacgccgatatggtcgatttcgaatgctggctgcagtggatcgccgacgag
caggtgacagccgcgcagaacgccgcccgtgacagcggtatggcactcggcctcatgcag
gatatggccgtgggcgtgcactcgctcggcgcggacgtgtggtggaatccggaacgtttc
gcagtaggcagcgtaaccgtgggctgcccaccggacttctacaaccagcagggtcaggat
tggggccagccgccgttcaatccgaattatctggccaaaactggttatggcgtgtaccgc
gagatggtgcacaacatgttctcgcacgcgggcgcggtgcgcatcgaccatatactcggc
ctattccgtctgtggtggattccgcagggcgaaggcgcgcgcggtggcgcgtacgttacg
tacgactatgaggcgatgatcgcgatcctgaccattgaagcgtcccgcgtgaacggtttg
gtggtcggcgaggatctgggcaccgtgcctgattacgtacgcacggtactcggcgagcac
ggcctgctgggctgcatggtggaatggttcgcccgcgtggacgactcccccaacgccggc
gacccgtacgccgatccgtccacgtaccgcaagtacgcgctggcttccgtcaccacgcac
gacctgccgccgaccgccggctacctgcagttcgagcacgtcaagctgcgcgaacagctg
cacctgctgtccggcccggtcgaggagttccaggcttccgccaccgccgaacgcgacgcg
atgatggaccgtcttgtggagtccggcctgatcacgccggaagtggcgggcgatgtggaa
ggccacatccaggaaatcgtcgaggcgatgcacaagatgctgctcaagtcgccgtccgtg
ctgctgcaggccgcgttggtggatggcgtgggcgagacgcgcacgcagaaccagccgggc
acgtccagtgaatactccaactggcgtgtgccgctggcaggcccggacctcaaggtggtg
cacaccgatgaggtgttcgatctgccgcgcgtgcaatcgcttgccgccatcatgaacggc
gagaagtag

DBGET integrated database retrieval system