KEGG   Bifidobacterium adolescentis ATCC 15703: BAD_1603Help
Entry
BAD_1603          CDS       T00437                                 

Definition
(GenBank) probable beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
bad  Bifidobacterium adolescentis ATCC 15703
Pathway
bad00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:bad00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BAD_1603
Enzymes [BR:bad01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BAD_1603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_14 Cellulase Glyco_hydro_35
Motif
Other DBs
NCBI-ProteinID: BAF40384
UniProt: A1A3V1
Position
2040109..2042187
Genome map
AA seq 692 aa AA seqDB search
MTMNQRREHRWPRPLEGRRARIWYGGDYNPDQWPEEVWDEDVRLMVKAGVNLVSVGIFSW
AKIEPREDVYDFGWLDRIIDNLGKAGIAVDLASATASPPMWLTQAHPEVLWKDYRGDVCQ
PGARQHWRPTSPVFCEYALKLCRAMAEHYKDNPYVVAWHVGNEYGCHNRFDYSEDAERAF
QDWCEERYGTIEAVNDAWGTAFWAQHLNDFSEIVPPRFIGDGNFMNPGKLLDFKRFSSDA
LKSFYVAERDALAEITPEKPLTTNFMVSAGGSVLDYDDWGGEVDFVSNDHYFIPGEAHLD
ELAFSASLVDGISRKDPWFLMEHSTSAVNWRPINYRKEPGQLVRDSLAHVAMGADAVCYF
QWRQSRSGAEKFHSAMLPHAGEDSQTFRDVCELGRDLGTLADEGLLGTKLAKSSVAIVFD
YESEWASEHTATPTQNVHHIDEPLAWFRALADVGVTADVVPIRSNWDEYDVAILPSVYIL
SEENTRRVRDYVANGGKLIATYYTGISDERDHVWLGGYPGSIRDVVGVRIEEFAPMGSDW
PGVPDHLDLDNGAVAHDIVDVIGSIGKDAKVLASFKDDPWTGMDGRPAIVSNPYGEGRSV
YVGARLGRDGIARSLPMILETLGVEVKDSSDPDLLRIERVDESTGARFTFLFNRTKEPVS
MLVEGRPVVMSLADCAGATVTINPNGVLVVKQ
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgacaatgaaccaacgtagagaacatcgttggcctcggccgttggagggccggcgggcc
cgtatctggtacggcggcgactacaatcccgaccagtggcccgaggaggtctgggacgag
gacgtgcgcctcatggtcaaggcgggagtgaacctcgtatccgtgggcatcttctcctgg
gcgaaaatcgaaccccgcgaagacgtgtacgatttcggctggctcgaccgaatcatcgac
aatctcggcaaggccggcatcgccgtagatctcgcttccgcgaccgcatccccgccgatg
tggctgacccaggcgcatcccgaggtgctgtggaaggactaccgcggtgacgtgtgccag
ccgggcgcgcgccagcactggcgtcccaccagtcctgtgttctgtgagtacgcattgaag
ctctgccgggcgatggcggagcattacaaggacaatccctatgtggtcgcttggcacgtt
ggtaacgagtacggatgccacaaccgcttcgactattccgaggacgccgaacgcgcgttc
caagactggtgcgaggaacggtacggcacgatcgaagcggtgaacgacgcatggggtact
gcgttctgggcccagcatctgaacgatttcagcgaaatcgttccgcctcgattcatcggc
gacggcaatttcatgaaccccggcaagctgctcgacttcaaacgcttcagctccgacgcg
ctgaagtcattctatgtggccgaacgtgacgcattggccgaaatcacaccagaaaagccg
ttgaccacgaatttcatggtctccgccggcggttccgtactggattacgacgattggggc
ggcgaggtcgatttcgtgtcaaacgaccattacttcattccgggcgaggcgcatctggac
gagctcgcgttctcggcttcgttggtggacggcatctcccgcaaggatccgtggttcctg
atggagcattccacctcggccgtgaactggagaccgatcaactatcgcaaggaacccggc
cagctggtgcgcgattccttggcgcacgtggccatgggagccgatgccgtgtgctacttc
cagtggcgccaatccaggtccggcgcggagaagttccattccgcgatgctgccgcatgcg
ggggaggattcccagacgttccgggacgtgtgcgaactgggccgtgatctgggcacgctt
gcggatgagggactgctcggcaccaagctggcgaaatccagcgtggccatcgtgttcgat
tacgagtccgaatgggcgagcgagcacaccgcgaccccgacgcagaacgtccatcatatc
gacgagccgctcgcatggttccgcgctctggcggacgtcggcgtgaccgcggacgtcgtt
ccaatccgttcgaactgggacgagtacgatgtcgcgatactgccgagcgtgtacatcctc
tccgaggagaacacccgtagggtgagggactacgtcgcgaacggcggcaagctcatcgcc
acgtactatacaggcatcagcgacgaacgggaccatgtgtggctcggcggttacccaggt
tccatccgggacgtcgtcggtgtgaggatcgaggagttcgcccctatgggatccgattgg
cccggagttccggaccacctcgatctcgacaacggagccgtcgcacacgacatcgtcgac
gtgatcggctcaatcgggaaggacgcgaaggtgctcgcctcgttcaaggatgacccatgg
accggcatggacggacgcccggccatcgtgtccaatccatatggcgaagggcgtagcgtc
tacgtcggagcccggctgggacgtgatggcatcgccagaagcctgccgatgatcctcgag
acccttggtgtggaagtcaaagactcctcggatccggacttgcttcgcatcgagcgcgtc
gatgagtcgacgggggctcggttcacgtttctgttcaaccggaccaaagaacctgtcagc
atgctggtggagggacgcccggtcgtcatgtcactggccgactgtgctggcgcgacggtt
accatcaatcccaatggcgtactcgtcgtcaaacaataa

DBGET integrated database retrieval system