KEGG   Bifidobacterium adolescentis 22L: BADO_0540Help
Entry
BADO_0540         CDS       T03260                                 

Definition
(GenBank) low specificity-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
badl  Bifidobacterium adolescentis 22L
Pathway
badl00260  Glycine, serine and threonine metabolism
badl01100  Metabolic pathways
badl01110  Biosynthesis of secondary metabolites
badl01120  Microbial metabolism in diverse environments
badl01130  Biosynthesis of antibiotics
badl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:badl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BADO_0540
Enzymes [BR:badl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     BADO_0540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AII75964
UniProt: A0A076JLR8
Position
complement(688915..689940)
Genome map
AA seq 341 aa AA seqDB search
MLSFENDYSCAATPEIIARLAETATNQYPGYGTDDVCESAKAKIREACACPDAEIFFLVG
GTQTNQVVIDAITPPYAGVVAATTGHVNVHEAGAIEFTGHKVLTLPHHDGKIDADELDEY
CATFYADGNYTHMVFPGCVYISQATEYGTLYTLAELEAIRKVCTKYDMPLFIDGARLGYA
LTATGNDVTIEDIARLADVFYIGGTKVGAMFGEAVVFTHGNMPKHFVTIVKQHGALLAKG
WLLGLQFDTLFTDGLYLRIARHANDAADRIRKVLVERGYTLTFDAPTNQIFVTLDNETSE
RLQRDVRLGFTEKADDTHTVMRICTSWATTDEQVDELVALL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgctgtctttcgaaaacgactactcctgcgccgcgacgccggaaatcatcgcccgtctc
gccgaaaccgcgaccaaccagtatcccggctacggcaccgacgacgtctgcgaaagcgcc
aaagccaaaatccgcgaggcatgcgcatgcccggacgccgaaatcttcttcctcgtcggc
ggcactcagaccaaccaggtcgtcatcgacgccatcaccccaccgtatgcgggcgtggtg
gcggccaccaccggacatgtgaacgtgcatgaggcgggcgctatcgaattcaccggccac
aaagtgctcacgctcccccaccatgacggcaaaatcgacgcggatgaactcgacgaatac
tgcgccacgttctacgcggacggcaactacacgcatatggtgttccccggctgcgtgtac
atttcgcaggccaccgaatacggcacgctgtacacgctggccgagctcgaggcgatccgc
aaggtctgcacgaagtacgacatgccgttgttcatcgacggcgcgcgtctcggctacgcg
ctgaccgccaccggcaacgacgtgacgatcgaggacatcgcgcgtctcgccgacgtgttc
tatatcggcggcaccaaggtgggcgcgatgttcggcgaggccgtggtgttcacgcacggc
aacatgccgaagcatttcgtgacgatcgtcaagcagcatggcgcgctgctggccaaggga
tggctgctgggactgcagttcgacacgttgttcaccgacggcctgtacctgcgcatcgcc
cgccacgccaacgatgccgcggaccgtatccgcaaggtgctggtggaacgtggctacacg
ctgactttcgatgcgccgaccaaccagatcttcgtcacgctcgacaacgagacctccgaa
cgtctgcaacgcgacgtccgtctcggcttcacggaaaaggcggacgacacgcataccgtg
atgcgcatctgcaccagctgggccacgaccgacgagcaggtggacgagctggtcgcactg
ctgtaa

DBGET integrated database retrieval system