KEGG   Bifidobacterium adolescentis 22L: BADO_1340Help
Entry
BADO_1340         CDS       T03260                                 

Definition
(GenBank) beta-glucosidase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
badl  Bifidobacterium adolescentis 22L
Pathway
badl00460  Cyanoamino acid metabolism
badl00500  Starch and sucrose metabolism
badl01100  Metabolic pathways
badl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:badl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BADO_1340
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    BADO_1340
Enzymes [BR:badl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     BADO_1340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3_C Glyco_hydro_3 Fn3-like
Motif
Other DBs
NCBI-ProteinID: AII76751
UniProt: A0A076JPW4
Position
complement(1619278..1621533)
Genome map
AA seq 751 aa AA seqDB search
MSENTYPSVNDLTLEEKASLTSGGDAWHLQGVEAKGIPGYMITDGPHGLRKSNSATTGEV
DLNNSVPATCFPPAAGLSSSWNPELIHQVGEAMAEECIQEKVAVILGPGVNIKRNPLGGR
CFEYWSEDPYLAGHEAVGIVAGVQSKGVGTSLKHFAANSQETDRLRISANISQRALREIY
FPAFEHIVKEAQPWTIMCAYNCINGVHAAQDRWLLTDVLRDEWGFQGIVMSDWGADHDRV
ASLNAGLNLEMPPSYTDDQIVYAARDGRIQPAQLDRMAQGMIDLVSKTRAAMSVENYRFD
IEAHDEVAHQAAVESMVLLKNDDAILPVAGDAKVTVIGEFARTPRYQGGGSSHITPTKMT
SFLDALTERGVDAKFAPGFTLDLEPADPALEAEAVEAAKGADVVLMFLGLPEAAESEGFD
RETLDMPAKQIALLEAVAAENKNVVVVLSNGSVVTVAPWAKNAKGILESWLLGQSGGPAL
ADVLFGKVSPSGKLAQTIPFDINDDPSTINWPGEEGHVDYGEGVFVGYRYYDTYNKAVDY
PFGFGLSYATFEVSDVKAVKTGACTATVSAVVKNTSNVDAAETVQVYVAPGKADVARPKH
ELKGFKKVFLKAGESAEVSFDLDDRAFAYWSEKFNDWHVESGEYAIEVGTSSRDIAGSAV
VELDGDGKTQPLTEWSNFMEWRKDPLGSKVLEKLRAEGEAGRMPIVPDNDMTRLFLDSMP
INSMSVLMSDGGKAITAFMLDEYAKIAETAE
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaaacacctatccttccgtcaatgacctgacgcttgaagaaaaggcatcccta
acttccggcggcgacgcttggcatctgcaaggcgttgaagccaagggcattcccggctat
atgatcaccgacggcccccacggcctgcgcaagtccaactcggccaccaccggcgaagtc
gatctgaacaactccgtgcccgccacctgcttcccgccggccgcgggcctgtccagctcg
tggaatccggaactcatccaccaggtcggcgaagccatggccgaagaatgcattcaggag
aaggttgccgtaattctcggtcccggcgtgaacatcaagcgcaacccgcttggcggccgc
tgcttcgaatactggtccgaagacccgtatctggcgggtcatgaggcggtcggcatcgtc
gcaggcgtgcagtccaagggcgtgggcacttcgctcaagcatttcgccgccaacagccag
gagaccgaccggctgcgcatcagcgccaacatctcccagcgtgcgctgcgcgaaatctac
ttcccggcattcgaacacatcgtcaaggaagcccagccgtggaccatcatgtgcgcatac
aactgcatcaacggcgtgcatgccgcccaggatcgctggctactcaccgacgtgctgcgc
gacgaatggggcttccaaggtatcgtcatgagcgactggggcgccgaccacgaccgcgtg
gcctccctcaatgcgggcctcaacctcgaaatgccgccaagctacaccgacgaccaaatc
gtctacgccgcacgcgacggccgcatccagccggcacagctcgaccgcatggcacaaggc
atgatcgacttggtcagcaagacccgcgcagccatgagcgtcgaaaactatcgtttcgac
atcgaagcccacgatgaggtcgcacatcaggccgccgtcgaatccatggtgctcctcaag
aacgatgacgccattctgccagtcgctggcgatgccaaggtcaccgtcatcggcgaattc
gcacgtaccccgcgctaccagggcggtggttcctcgcacatcaccccaaccaagatgacc
agcttcctggacgccctcaccgaacgcggcgtggatgccaagttcgccccaggattcacc
ctcgacctcgaaccggccgatccggcactcgaagccgaagccgtcgaagctgccaagggc
gccgacgtggtgctcatgttcctagggctccctgaagcggccgaatccgaaggcttcgac
cgtgagaccctcgacatgccggccaagcagatcgcactgctcgaagccgtcgcagccgaa
aacaagaacgttgtggtcgtactctccaacggctccgtcgtcaccgtggcaccatgggcc
aagaacgccaagggcatcctcgaatcctggctgctcggacagtccggcggtccggcgctc
gccgacgtgctgttcggcaaggtgagcccgtccggcaagcttgcgcagaccattcccttc
gacatcaacgacgatccgagcaccatcaactggccgggtgaagaggggcatgtcgattat
ggcgaaggcgtgtttgtgggctaccgctattacgacacctacaacaaggccgtcgactac
ccgttcggcttcggcttgagctacgccacgttcgaagtgagcgacgtgaaggccgtcaag
accggtgcctgcaccgcaaccgtcagcgcagtggtcaagaacacctcgaacgttgacgcc
gccgaaaccgtgcaggtgtacgtggctcctggcaaggctgacgtggcccgcccgaagcac
gagctcaaaggcttcaagaaggtgttcctcaaagccggcgaatccgccgaagtctccttc
gacctcgacgatcgcgccttcgcctactggtctgagaagttcaacgactggcatgtggag
agcggcgaatacgccatcgaggttggcacgtccagccgtgacatcgccggttccgcggta
gtggagctcgatggagacggcaagacccagccgctcaccgaatggtccaacttcatggaa
tggcgtaaggatccgctcggttccaaggtgctcgagaagctgcgtgccgaaggtgaagcc
ggccgcatgccgatcgtgcccgacaatgacatgacccgtctattcctcgactccatgccg
atcaacagcatgtcggtgctgatgagcgacggcggcaaggccatcaccgccttcatgctc
gacgaatacgccaaaatcgccgaaaccgccgaataa

DBGET integrated database retrieval system