KEGG   Bacillus atrophaeus 1942: BATR1942_00630Help
Entry
BATR1942_00630    CDS       T01339                                 

Definition
(GenBank) acetoin reductase/2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bae  Bacillus atrophaeus 1942
Pathway
bae00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BATR1942_00630
Enzymes [BR:bae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BATR1942_00630
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BATR1942_00630
    1.1.1.-  
     BATR1942_00630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N 2-Hacid_dh_C F420_oxidored
Motif
Other DBs
NCBI-ProteinID: ADP31086
UniProt: A0A0H3DWA7
Position
complement(134656..135696)
Genome map
AA seq 346 aa AA seqDB search
MKAARWHNQKDIRIENIEEPKTEPGKVKIKVKWCGICGSDLHEYLGGPIFIPVEKPHPLT
KEVAPVTMGHEFSGEVVEIGEGVENYKIGDRVVVEPIFATHGHQGAYNLDEQMGFLGLAG
GGGGFSEYVAVDEELLFKLPEELSYEQGALVEPSAVALYAVRSSKIKAGDKAAVFGCGPI
GLLVIEALKAAGATEIYAVELSPERQQKAEELGAIIIDPAKVGDAVEEIISRTGGGVDVS
FEVTGVPVVLRQAIQSTTIAGETVIVSIWEKGAEILPNDIVIKERTVKGIIGYRDIFPSV
LSLMKKGYFSADKLVTKKIVLDDLIDEGFGALIKEKDQVKILVKPN
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgcaagatggcataatcaaaaagacatccgtattgaaaacattgaagaaccg
aaaacagaacccggcaaagtaaaaatcaaagtgaaatggtgcgggatttgcggcagtgac
ttgcatgaatatttaggcggcccaatctttatcccggtcgaaaaaccacatccgcttact
aaggaagtcgcgcctgtcacgatgggccatgagttttccggtgaagttgttgaaattggt
gaaggcgtagaaaactataaaatcggtgatcgcgtcgtcgtcgaaccgattttcgctacc
cacgggcaccaaggcgcctacaatctggacgagcaaatgggctttcttggcttagcagga
ggcggaggcggtttttccgaatatgttgccgttgatgaagaactgttatttaaacttcct
gaagagctgtcctatgagcaaggggcgcttgttgaaccatccgcagtcgctctttacgct
gtccgttccagcaagattaaagccggtgacaaagcagctgtctttgggtgcggaccgatc
ggccttttagtgattgaagcgcttaaagcagccggtgcaactgaaatatatgctgttgag
ctgtcccctgaacgtcagcaaaaagcggaagaacttggagctatcatcattgatccggcc
aaagtcggcgatgccgttgaagaaatcatcagccgcacgggcggcggtgtagacgtttca
tttgaagtaacaggagttccggttgtattgcggcaagcgatccaatcaacaaccattgcc
ggtgaaacggtgatcgtcagcatttgggaaaaaggcgctgagatccttccgaatgatatc
gttattaaagaacgtacagtcaaagggattatcggctaccgcgatatcttcccttccgta
ctatccttaatgaaaaaaggatatttctcagccgataaactggtaaccaaaaaaatcgtt
ttagatgacttaattgatgaaggctttggagcccttattaaagagaaagaccaggtgaaa
atcctggtaaaaccaaattaa

DBGET integrated database retrieval system