KEGG   Bacillus atrophaeus: BATR1942_05395Help
Entry
BATR1942_05395    CDS       T01339                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
bae  Bacillus atrophaeus
Pathway
bae00471  D-Glutamine and D-glutamate metabolism
bae00550  Peptidoglycan biosynthesis
bae01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bae00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BATR1942_05395 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BATR1942_05395 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bae01011]
    BATR1942_05395 (murD)
Enzymes [BR:bae01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     BATR1942_05395 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:bae01011]
 Precursor biosynthesis
  Amino acid ligase
   BATR1942_05395 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: ADP32033
UniProt: A0A0H3E107
Position
1047182..1048537
Genome map
AA seq 451 aa AA seqDB search
MEKEQVLQNQHFLVLGLAKSGYAAASILHEKGAYVVVNDQKPFEENEPAQKLSNKGIDVI
CGEHPTSLFDQHRITVLIKNPGIPYENVMVQEAEKRGIPVWTEIELAYYVTDAKFIGITG
SNGKTTTTTLIYEMLKADSQKALIAGNIGTVASEVAYHADGDEWIVTELSSFQLMGTHAF
RPHISLILNVFDAHLDYHHSRENYEKAKQNVYLHQLESDTAVVNQDDETVVRLAEAGKAA
SLAFSATKPLERGACVKDGMILFDNEAILSLEDVVLPGAHNLENILAAVAVVKTAGASNE
AIKKVLTSFTGVKHRLQYVTTIQDRKFYNDSKATNVLATSKALSAFEKPVLLLAGGLDRG
NGFDELKPYMQNVKAILTFGQTAPKLEKLGAELGIQHVKRVDNVEQAVSAAFALSNEGDV
ILLSPACASWDQFKTFEERGDMFIDAVHMLK
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaaagaacaagtgttacagaatcagcattttttagtcctcggactggcgaaaagc
ggatatgcggcagcttctattcttcatgaaaaaggggcttacgttgttgtgaacgatcaa
aagccatttgaagaaaacgagcccgcccagaagctttcgaataaaggaattgacgtgatt
tgcggcgagcatccgacgtccctttttgaccagcaccgcattacggtactgattaaaaac
ccgggcattccatatgaaaatgtcatggtgcaggaagcggaaaaaaggggtattccggtc
tggacggaaatagaacttgcctattatgtaacggatgcaaaatttatcggaatcacaggt
tcgaacggaaaaacaacaacaacaacgcttatttatgaaatgctgaaggctgattctcaa
aaagcgctgatcgctggaaatatcgggacagtcgcaagcgaggtcgcttatcatgctgac
ggagatgaatggatcgtcacggagctttcttcttttcagcttatggggactcatgcgttc
agaccgcacatcagtcttattctaaacgtatttgacgcccatcttgattatcaccattcg
agagaaaactatgaaaaagcgaagcagaacgtatatttgcaccagctggaatcagacacg
gccgttgtcaatcaagatgatgaaactgttgtacgtctggcggaagcaggaaaagcagcc
tctcttgcgttttcagcaacaaagccgcttgagcgaggcgcatgcgtaaaagacggaatg
atcttgtttgataacgaagccatactttctttggaagatgtcgtactgcccggcgcgcac
aatcttgagaatattttggccgccgttgcggttgtcaaaacggcgggagcgtctaacgaa
gcgatcaaaaaggtccttacaagctttacaggcgtaaagcaccgccttcaatacgtgaca
acgattcaggaccgtaaattttataacgacagcaaagcaacgaacgtattagcgaccagc
aaggcgctttccgcctttgaaaaaccggttcttctccttgcaggcgggcttgaccgcggt
aacggttttgacgaactaaaaccttatatgcaaaatgtaaaagcgattcttactttcggc
cagacggctcctaaactcgaaaaactcggggctgaactgggaatacaacatgtcaaacgt
gtcgataatgttgaacaagcagtatcggcggcgtttgcgctctcaaatgaaggggatgtc
atcctgttgtcaccggcttgcgcaagctgggaccagttcaaaacatttgaagaacgcggt
gacatgtttatagacgccgtgcatatgcttaaataa

DBGET integrated database retrieval system