KEGG   Bacillus atrophaeus 1942: BATR1942_09260Help
Entry
BATR1942_09260    CDS       T01339                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
bae  Bacillus atrophaeus 1942
Pathway
bae00790  Folate biosynthesis
bae01100  Metabolic pathways
Module
bae_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bae00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BATR1942_09260 (folE)
Enzymes [BR:bae01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     BATR1942_09260 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ADP32785
UniProt: A0A0H3E0K3
Position
complement(1845422..1845994)
Genome map
AA seq 190 aa AA seqDB search
MKEVNKEQIEQAVRQILEAIGEDPNREGLLDTPKRVAKMYAEVFSGLNEDPKEHFQTVFG
EDHEELVLVKDIAFHSMCEHHLVPFYGKAHIAYIPRGGKVTGLSKLARAVEAVAKRPQLQ
ERITSTIAESIVETLDPHGVMVVVEAEHMCMTMRGVRKPGAKTVTSAVRGIFKNDAAARS
EVLDHIKRHD
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagttaataaagaacagattgaacaagcggttcgccaaattttagaagcgatt
ggagaagacccaaaccgggaagggctgttggacactccgaaaagagtcgcaaaaatgtac
gccgaagttttttccggactgaatgaagatccaaaagaacattttcaaaccgtcttcggt
gaggaccatgaagagcttgttcttgtgaaggatatcgcatttcattctatgtgtgagcat
catcttgttcctttttacggaaaagcgcacattgcttatataccgcgcggcggaaaggtc
acaggcctcagtaaattggctcgtgccgtcgaagccgtagcaaagcgccctcagcttcag
gagcgcattacatcaacgattgcagaaagcatcgtggaaacactcgatccgcacggcgtg
atggttgtagttgaggcggagcatatgtgcatgacaatgagaggcgtcagaaagccgggg
gcaaaaacagtcacttctgctgtgcgaggcattttcaaaaacgatgctgctgcccgttct
gaagtgttagatcatattaaacgacatgactaa

DBGET integrated database retrieval system