KEGG   Bacillus atrophaeus 1942: BATR1942_10215Help
Entry
BATR1942_10215    CDS       T01339                                 

Definition
(GenBank) NADPH dehydrogenase NamA
  KO
K00354  NADPH2 dehydrogenase [EC:1.6.99.1]
Organism
bae  Bacillus atrophaeus 1942
Brite
KEGG Orthology (KO) [BR:bae00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BATR1942_10215
Enzymes [BR:bae01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.1  NADPH dehydrogenase
     BATR1942_10215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_FMN Dus G3P_antiterm AP_endonuc_2 Luteo_P1-P2
Motif
Other DBs
NCBI-ProteinID: ADP32974
UniProt: A0A0H3E5F2
Position
1996852..1997868
Genome map
AA seq 338 aa AA seqDB search
MSRKLFTPWSVKDVTIKNRIVMSPMCMYSSHNKDGKLQPFHMAHYITRAIGQVGLIIVEA
TAVTPQGRISDQDLGIWSDDHIEELSKLTEQVKAQGSKIGIQLAHAGRKAELEGDIYAPS
AIAFDEHSNTPVEMTEEKIKETIQEFKQAAVRAKEAGFDIIELHAAHGYLIHEFLSPLSN
HRTDEYGGSPENRYRFLRETIDEVKQVWDGPLFVRVSASDYTPKGLDIADHIGFAKWMKE
QGVDLIDCSSGALVHADINVFPGYQVSFADKIREQADIPTGAVGMITNGLAAEEILQNGR
ADLIFIARELLRDPFFARTAAQQLNTNIPAPVQYDRAW
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
ttgagcagaaaattatttactccgtggagtgtaaaagatgtaaccataaaaaaccgcatt
gtgatgtctccaatgtgcatgtactcctctcataataaagatgggaaactgcagccgttc
cacatggcccattacataacccgcgcaatcggacaggtggggctgattatcgttgaagcg
acagccgttacccctcaaggccggatttcggatcaagatttgggaatctggagcgatgat
catatcgaagagctttcaaagctgacagaacaggtgaaagcccaaggttcaaaaatcggc
attcagctcgcgcacgccggccgaaaagctgagcttgaaggagatatttacgctccgtca
gccattgcgtttgatgaacattcaaacacgccggttgaaatgacagaggaaaaaattaaa
gagacgattcaggagtttaaacaggctgctgtccgcgcaaaagaagccggctttgatatt
attgaattgcatgcagcgcacggatacttaattcatgagttcttatctccgctttccaat
catcgcacagatgaatacggcggttcaccggaaaatcgctaccgctttttaagagaaaca
attgatgaagtcaaacaagtatgggacggtcctttatttgttcgcgtttctgcttctgac
tacacaccaaaagggttagacatcgcggatcacatcgggtttgccaaatggatgaaggag
cagggcgtcgatctaatcgattgcagctcaggagctcttgttcatgccgatattaacgtg
ttccccggctaccaggtgagtttcgccgataagatccgcgaacaggctgacataccgaca
ggggcggtaggaatgattacaaatggtttagcagctgaagaaattttgcaaaacggccgc
gctgatcttatttttattgccagagagcttttgcgggacccatttttcgcaagaaccgct
gctcaacagctgaatacaaacattccggcgcccgtacaatacgatagagcgtggtaa

DBGET integrated database retrieval system