KEGG   Bacillus atrophaeus 1942: BATR1942_12350Help
Entry
BATR1942_12350    CDS       T01339                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bae  Bacillus atrophaeus 1942
Pathway
bae00020  Citrate cycle (TCA cycle)
bae00480  Glutathione metabolism
bae01100  Metabolic pathways
bae01110  Biosynthesis of secondary metabolites
bae01120  Microbial metabolism in diverse environments
bae01130  Biosynthesis of antibiotics
bae01200  Carbon metabolism
bae01210  2-Oxocarboxylic acid metabolism
bae01230  Biosynthesis of amino acids
Module
bae_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bae_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BATR1942_12350
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BATR1942_12350
Enzymes [BR:bae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BATR1942_12350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ADP33401
UniProt: A0A0H3E2K4
Position
complement(2411418..2412689)
Genome map
AA seq 423 aa AA seqDB search
MAQAEKITVTDGVLNVPNNPIIPFIEGDGIGPDIWKAASRVLEAAVEKAYKGEKKITWKE
VYAGEKAFNKTGEWLPNQTLEDIREYLIAIKGPLTTPIGGGIRSLNVALRQELDLFTCLR
PVRYFNGVPSPVKRPQDTDMVIFRENTEDIYAGIEYAKGSEEVEKLINFLKTELGVNKIR
FPETSGIGIKPVSEEGTQRLVRAAIQYAIDQNRKSVTLVHKGNIMKFTEGAFKNWGYEVA
EKEFGDKVFTWAEYDRIVEQDGKDAANKAQSEAEAAGKIIIKDSIADIFLQQILTRPSEF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVLLSGVLLLEHLGWQEAADLVVQSVEKTIESKVVTYDFARLMDGATEVKCSEFADELIK
NLS
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtggcacaagctgaaaaaattacagttactgacggtgtattgaatgtaccgaacaatccg
attatcccgtttatcgaaggtgacggcatcggccctgatatttggaaagcggcttcaaga
gttctggaagcagctgtagaaaaagcatataaaggcgaaaagaaaatcacttggaaagaa
gtttatgcaggtgaaaaagcatttaacaaaacgggtgaatggctgcctaaccaaacgctt
gaagacatccgcgaatatttaatcgccattaaaggcccgcttacaactccgatcggcggc
ggaatccgttcattaaacgtagcgctcagacaggaattagacttgtttacatgtcttcgt
ccagtcagatactttaacggcgtaccttcgcctgttaagcgccctcaagatacggatatg
gttattttccgtgaaaatacggaagatatctacgctggaatcgagtacgcaaaaggctct
gaagaagtggaaaaattaatcaacttcttaaaaactgagcttggtgtcaacaaaatccgt
ttccctgaaacatcaggcatcggtattaagcctgtttcagaagaaggcacacagcgtctt
gtaagagcggccattcaatatgcaattgaccaaaaccgcaaatcagtcacattggttcat
aaaggcaacatcatgaagttcactgaaggagcctttaaaaactggggctatgaagtggct
gaaaaagaatttggagataaagtctttacatgggctgaatatgatcgtattgtagaacag
gatgggaaagatgcagcaaacaaagcgcaaagcgaagctgaggctgccggcaaaatcatt
atcaaagacagcattgctgatatcttccttcaacaaattttaacgcgtccaagcgaattt
gatgtggtagctacaatgaacttaaacggcgactacatttccgatgcacttgcagcgcaa
gtcggcggaatcggtatcgcgcctggggctaacatcaattacgaaacaggacacgctatt
ttcgaagcaactcacggaacggcgcctaaatacgcgggacttgataaagtgaacccgtca
tctgttcttctttcaggcgtgcttttacttgagcaccttggatggcaggaagctgctgat
cttgtggttcaatccgttgaaaaaacaattgaatctaaagtcgtaacttacgattttgct
agattaatggacggtgccacagaagtgaagtgctcggaatttgctgacgaattaatcaaa
aacttgtcttaa

DBGET integrated database retrieval system