KEGG   Bacillus atrophaeus 1942: BATR1942_14940Help
Entry
BATR1942_14940    CDS       T01339                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bae  Bacillus atrophaeus 1942
Pathway
bae00010  Glycolysis / Gluconeogenesis
bae00051  Fructose and mannose metabolism
bae00562  Inositol phosphate metabolism
bae01100  Metabolic pathways
bae01110  Biosynthesis of secondary metabolites
bae01120  Microbial metabolism in diverse environments
bae01130  Biosynthesis of antibiotics
bae01200  Carbon metabolism
bae01230  Biosynthesis of amino acids
Module
bae_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bae_M00002  Glycolysis, core module involving three-carbon compounds
bae_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bae00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BATR1942_14940 (tpiA)
   00051 Fructose and mannose metabolism
    BATR1942_14940 (tpiA)
   00562 Inositol phosphate metabolism
    BATR1942_14940 (tpiA)
Enzymes [BR:bae01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BATR1942_14940 (tpiA)
Exosome [BR:bae04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BATR1942_14940 (tpiA)
  Exosomal proteins of bladder cancer cells
   BATR1942_14940 (tpiA)
  Exosomal proteins of melanoma cells
   BATR1942_14940 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADP33910
UniProt: A0A0H3E7R9
Position
complement(2924975..2925736)
Genome map
AA seq 253 aa AA seqDB search
MRKPIIAGNWKMNKTLGEAVSFVEEVKSSIPAADKAEAVVCAPALFLEKLATAVKGTDLK
VGAQNMHFEENGAFTGEISPVALKDLGVEYCVIGHSERREMFAETDETVNKKAHAAFKHG
IVPIICVGETLEEREAGKTNDLVADQVKKGLAGLSQDQVAESVIAYEPIWAIGTGKSSTS
QDANDVCAHIRQTVAGEFGQETADKLRIQYGGSVKPANIKEYMAQSDIDGALVGGASLEP
QSFVQLLEEGQYE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaccaattatagccggtaactggaaaatgaacaaaacactcggcgaagctgtc
agctttgttgaagaagtgaaatcttccatcccagcagcagacaaagctgaagctgtagtt
tgcgcaccagcgcttttcttagaaaaactggctacagctgtgaaaggcactgatcttaaa
gtcggcgcccaaaacatgcactttgaagaaaacggcgcgttcacaggcgaaatcagcccg
gtagcattgaaagaccttggcgttgaatactgcgtcatcggccactcagagcgccgcgaa
atgttcgctgaaacggacgaaacggttaacaaaaaagcacacgctgctttcaaacacggc
attgtgccgattatctgtgtaggcgaaacgcttgaagagcgtgaagcaggcaaaacaaac
gatcttgttgcagatcaagtgaaaaaaggccttgccggactttctcaagatcaagtcgca
gaatctgttattgcttacgagcctatttgggcaatcggaacaggcaaatcttctacatct
caagatgcaaatgacgtgtgcgcgcacatccgtcaaacagttgctggcgaattcggccaa
gaaactgctgacaaactgcgcattcaatacggcggaagcgtaaagcctgccaacattaaa
gaatatatggcccagtccgatattgacggtgctttggttggcggcgcaagcttagagcca
cagtcattcgttcaattattggaggaaggtcaatatgagtaa

DBGET integrated database retrieval system