KEGG   Bacillus atrophaeus 1942: BATR1942_16705Help
Entry
BATR1942_16705    CDS       T01339                                 

Definition
(GenBank) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
bae  Bacillus atrophaeus 1942
Pathway
bae00330  Arginine and proline metabolism
bae01100  Metabolic pathways
Module
bae_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:bae00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BATR1942_16705
Enzymes [BR:bae01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     BATR1942_16705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-ProteinID: ADP34260
UniProt: A0A0H3E8I6
Position
complement(3270308..3271180)
Genome map
AA seq 290 aa AA seqDB search
MRFDEAYSGKVFIASRPGWEEADAILYGMPMDWTVSYRPGSRFGPGRIREVSIGLEEYSP
YLDRDLADLNFFDAGDIPLPFGNPQKSLDLIEEYVDSILEKDKFPLGMGGEHLVSWPVIK
AMYKKYPDLAIIHFDAHTDLRVDYEGEPLSHSTPIRKAAELIGPGNVYSFGIRSGMKEEF
EWAKENGMHISKFEVLEPLKEVLPKLAGRPVYVTIDIDVLDPAHAPGTGTVDAGGITSKE
LLASVHEIARSEVNVKGADLVEVAPIYDHSEQTANTASKVIREMLLGFVK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgagatttgatgaagcttattcaggaaaagtatttatcgcgagccgcccgggctgggaa
gaggcggacgccatcctttacggcatgccgatggattggacggtcagctatcgtcccgga
tcaagattcggtccgggaagaatccgcgaggtgtcaatcggtcttgaagagtatagcccg
tatttggaccgcgaccttgccgacctcaatttctttgacgccggcgacatcccgcttccg
ttcggcaacccgcaaaagagccttgatttgattgaggaatatgtggacagcattttggaa
aaagacaaattcccgcttggcatgggaggggagcatcttgtgtcttggcctgttatcaaa
gcgatgtacaagaaatatccggaccttgcgattatccattttgacgcacatacggacctt
cgcgttgattatgagggggaaccgctttctcactccacgccgatccgcaaagcggctgaa
ttaatcgggccgggcaatgtctattcattcggaatccgttctggcatgaaggaagaattt
gaatgggcgaaggagaacgggatgcacatttcgaaatttgaagtgcttgaaccgctgaaa
gaggttcttccgaagctggcaggccgtccggtatatgtcaccatcgatattgacgtatta
gaccctgcacatgcaccgggaacagggacggttgacgccgggggcatcacgtctaaagaa
ctgcttgcatccgtccatgaaattgcgcgttcagaagtaaacgtgaagggcgcggattta
gtagaagtagctccgatttacgatcattcagaacaaaccgctaacacggcgagcaaagtc
attcgtgaaatgctactgggctttgtgaaatag

DBGET integrated database retrieval system