KEGG   Bacillus atrophaeus 1942: BATR1942_18680Help
Entry
BATR1942_18680    CDS       T01339                                 

Definition
(GenBank) deoxyadenosine/deoxycytidine kinase
  KO
K15519  deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
bae  Bacillus atrophaeus 1942
Pathway
bae00230  Purine metabolism
bae00240  Pyrimidine metabolism
bae01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bae00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BATR1942_18680
   00240 Pyrimidine metabolism
    BATR1942_18680
Enzymes [BR:bae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     BATR1942_18680
    2.7.1.76  2'-deoxyadenosine kinase
     BATR1942_18680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dNK AAA_18 Thymidylate_kin AAA_28 SKI TsaE AAA_22 AAA_33 Cytidylate_kin2 RsgA_GTPase ABC_tran AAA_16 Cytidylate_kin PRK RNA_helicase AAA_25 MMR_HSR1 AAA_5 AAA ParA
Motif
Other DBs
NCBI-ProteinID: ADP34653
UniProt: A0A0H3E8J7
Position
complement(3651033..3651686)
Genome map
AA seq 217 aa AA seqDB search
MKEHHIPKDSIITVAGTVGVGKSTLTRTLAKRLGFKTSLEEVDHNPYLEKFYHDFERWSF
HLQIYFLAERFKEQKNIFEAGGGFVQDRSIYEDTGIFAKMHADKGTMSKVDYKTYTSLFE
AMVMTPYFPHPDVLIYLEGDLNNILARIEERGREMELQTNRSYWEEMYTRYENWISGFNA
CPVLKIRIEDYDLLNDEDSIEKIIDQVSTVIHETRKK
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaacatcatatacccaaggattcaatcattactgtagcaggaacagtaggcgtc
ggaaaatcaacgttaacaagaacgctggccaaacggctcggctttaaaacctctcttgaa
gaagtggatcataacccatacttagaaaagttttatcacgattttgaacgctggagcttt
catttacaaatctattttttagccgaacgtttcaaagaacaaaaaaatatatttgaagcc
ggcggcgggtttgtgcaagaccgttctatttatgaagatacagggatttttgcaaaaatg
cacgctgataaagggaccatgtcaaaggtcgattataaaacgtatacaagcctttttgaa
gccatggtgatgaccccctactttccacaccctgacgttctgatttatctagaaggcgat
ttaaataacattttggcacgcattgaagaacggggacgtgaaatggagctgcaaacaaac
cgttcttattgggaagagatgtacacccggtacgaaaactggataagcggatttaacgct
tgccccgttttgaaaattcgcatcgaggattatgatttgctgaatgatgaagactctatc
gaaaaaatcattgatcaagtcagcacagtgattcatgaaacaagaaaaaagtga

DBGET integrated database retrieval system