KEGG   Bacillus atrophaeus 1942: BATR1942_19215Help
Entry
BATR1942_19215    CDS       T01339                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
bae  Bacillus atrophaeus 1942
Pathway
bae03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bae00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BATR1942_19215 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bae03011]
    BATR1942_19215 (rplV)
Ribosome [BR:bae03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BATR1942_19215 (rplV)
  Bacteria
    BATR1942_19215 (rplV)
  Archaea
    BATR1942_19215 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ADP34760
UniProt: A0A0H3E9V0
Position
3761412..3761753
Genome map
AA seq 113 aa AA seqDB search
MQAKAVARTVRIAPRKARLVMDLIRGKQVGEAVSILNLTPRAASPIIEKVLKSAIANAEH
NYELDANSLVITQAFVDEGPTLKRFRPRAMGRASQINKRTSHITIVVSEKKEG
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcaaaagctgtcgcaagaacagtccgtattgctcctcgtaaagcacgtctagta
atggacctgattcgaggcaagcaagtaggtgaagcagtatctatcttgaacctaacaccg
agagctgcttctccaattattgaaaaagttttaaaatctgcaatcgcaaacgctgagcat
aactatgaattggacgctaacagtctggttattactcaagctttcgttgacgaaggccct
acgttaaaaagattccgcccacgtgctatgggacgtgcgagccaaatcaacaaacgtact
agccacattacaatcgttgtatcagaaaagaaggagggataa

DBGET integrated database retrieval system