KEGG   Bacillus atrophaeus 1942: BATR1942_20045Help
Entry
BATR1942_20045    CDS       T01339                                 

Definition
(GenBank) putative dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
bae  Bacillus atrophaeus 1942
Pathway
bae00030  Pentose phosphate pathway
bae01100  Metabolic pathways
bae01120  Microbial metabolism in diverse environments
bae01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BATR1942_20045
Enzymes [BR:bae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     BATR1942_20045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase
Motif
Other DBs
NCBI-ProteinID: ADP34924
UniProt: A0A0H3E9C0
Position
3932091..3932867
Genome map
AA seq 258 aa AA seqDB search
MYEDLQGKTAIVTGSSKGIGKAIAERFGKEKMNVVVNYHSDPSGAEETIETIKQNGGQAV
AVEADVSSEAGIEALMDTALQQFGTLDVMVNNSGFNGAEAMPHEMSLEDWQKVIDVNVTG
TFMGAKAALKHMMKHNIKGNVLNISSVHQQIPRPLNVQYSTSKGGMKLMTETLALNYADK
GIRVNALAPGTIATESNDDLQEEEHKQVQLKKIPMKTFGKPEEVAAAAAWLVSEEASYVT
GTTLFVDGGMTLYPSQLE
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaagatttacaaggaaaaacagcgatcgtgacaggatcgtcaaaaggaatagga
aaagccattgccgaacgcttcggaaaggaaaaaatgaacgttgttgtgaattatcacagc
gacccgagcggagcggaggaaacaatcgaaacgatcaagcaaaacggcggccaagctgta
gcggttgaggctgatgtgtcctcggaagcgggaattgaggctttgatggatacggcctta
caacagtttggcacactcgatgtgatggtgaataattcaggttttaacggcgctgaagca
atgccgcacgaaatgagtctggaagattggcaaaaggtgattgatgtgaatgtaacaggg
acctttatgggggcaaaggcggcgctgaagcacatgatgaagcacaacatcaaaggaaat
gtattaaacatctccagcgtccatcagcaaattccgcgtccgctgaatgtacaatattcc
acgtccaaaggcggcatgaagctcatgacagaaacgttagcgctgaactatgctgacaag
ggcattcgagtcaatgctctggcaccgggaacaatcgcaacggaatcaaacgatgatctt
caagaggaagaacataaacaagtacagctgaaaaaaattccgatgaaaacattcggcaaa
cccgaagaagttgccgccgcggcagcatggctcgtatcagaggaggcaagctacgtgacc
ggaaccacactctttgtagacggcggcatgacgctgtatccgtctcagctggaatag

DBGET integrated database retrieval system