KEGG   Borrelia afzelii (FLI): BAPKO_0142Help
Entry
BAPKO_0142        CDS       T00383                                 

Gene name
acrB
Definition
(GenBank) acriflavine resistance protein
  KO
K03296  hydrophobic/amphiphilic exporter-1 (mainly G- bacteria), HAE1 family
Organism
baf  Borrelia afzelii (FLI)
Brite
KEGG Orthology (KO) [BR:baf00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BAPKO_0142 (acrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACR_tran MMPL
Motif
Other DBs
NCBI-ProteinID: ABH01405
Position
complement(138185..141397)
Genome map
AA seq 1070 aa AA seqDB search
MLVKRIVGKPITMLILFSLLMMISLYTFSRLKVDLLPGIDIPQISINTVYPGASPKEVEE
SVSRVLESGLSSLKNLKNIYSISSKENSTVSLEFYHGTDLDLVLNEIRDALELVKSSLPS
RAQTPRIFRYNLKNIPVMEIVINSVRPVSELKRYADEIIKPGLERLDGVAIVTVNGGSKK
RVLIEVSQNRLESYGLSLSKVSSIIASQNLELSAGNILENNLEYLVQVSGKFKSIEEIGN
VVIAYKMPDNSSGINLSPIEIKLKDIANIKTDFEDLSEYVEYNGLPSISLSVQKRSDANS
ITVSNVVTGEIEKLKLSMPKDMRLEIASDSTNFIKASISTVVSSAYFGAMLAIFVIFFFL
RSFRATIIIGISIPIAIVLTFCLMYFVNISLNIMSLAGLALGIGMVVDCSIVVIDNIYKY
RQKGAKLISSSILGAQEMMMPITSSTFTSICVFGPFLIFKSELGVYGDFFKDFSFTIVIS
LGVSLLVAIFLVPVLSSHYVGLYTSFQKNIKSTFIRKIDAFFASIYYFLEFLYINLLNIV
LNHKLIFGLIVFFSFIGSLFLGLLLDVTTFDRGKENSIVINLNFPHKTSLEYAKFYSNRF
LEIVKSEAKGYKSIISTLDADRITFNVLFPLKEESKDELIKSIDYDAIKYKIMDRIGNLY
PEFNIEPSSGNALGGGDSIKIKISGNDFEYMKDYGKILVSMLKKEIPELVNPRLSINDAQ
LQIGVEIDRALVYNYGIDMNTILNELKANVNGVIAGQYVENGLNYDIVLKLDRMDVKNLK
DLEKIFIINSSGVKIPFSSIATFEKTNKAESIYRENQALTIYLNAGISPNDNLTQVTAKV
VDFINNKVPHKEGTVLKVEGEYNEFSNIMNQFKIIIMMAIVVVFGIMASQFESFLKPFII
IFTIPLTAIGVVLIHFLAGEKLSIFAAIGMLMLVGVVVNTGIVLVDYTGLLIKRGFGLRE
AIVESCRSRFRPILMSSLTSIIGLIPMAFSSGSGNELLKPIAFTFIGGMTASTFLTLFFI
PMLFEVFSNIVSSFKFKLKRVMSNVDVEKSFKINNSTKSSYNNLFEEDGD
NT seq 3213 nt NT seq  +upstreamnt  +downstreamnt
atgttggtaaagagaatagttggcaaaccaataacaatgttgattttattttcattgtta
atgatgataagtttatataccttttcaagattaaaagtagatcttttgcctggaattgat
attccccaaataagtattaacactgtttatcctggtgcttctcctaaagaagttgaagag
agtgtttctagagtccttgagagtggcttgagttcgttaaagaatttaaaaaatatatat
agcatttcttctaaagaaaatagcactgtttcacttgaattttatcatggaaccgattta
gatttggttttaaatgaaattcgagatgctcttgaattggtaaaatcttcattgcccagt
agagcacagacccccagaatttttagatacaatcttaaaaatattcctgtaatggaaatt
gttattaattctgtaaggccagtttctgagcttaaaagatatgctgatgagattattaag
cctggacttgaaaggcttgatggagttgcgattgttacagttaacggcggaagtaaaaaa
cgtgttttaattgaggtttctcaaaacagattagagtcttatgggctttctttgtcaaaa
gtatcttcgattatagcatctcaaaatttagaactttcagctggcaatatattagagaat
aatttggaatatttggttcaagtttctggaaaattcaaatcaattgaagaaataggcaat
gtggttatagcttataagatgcctgacaattcttctggcataaatttatctcctattgag
ataaaacttaaagatattgctaatattaaaactgattttgaagatttgtcagaatatgtt
gaatataatgggttgccttcaatttctttatcggttcaaaaacgtagtgatgctaattct
attacagtttctaatgttgttacgggtgaaatagaaaaattgaaattatctatgcctaaa
gatatgagattagaaattgcttctgatagcactaattttattaaagcgtccatttcaaca
gttgtaagttcagcctattttggggccatgcttgcaatatttgttatttttttctttctc
agaagctttagggccacaataattattggaatttctattccaatagcaattgttttgacc
ttttgtttaatgtattttgtaaatatttctcttaatattatgagtcttgcaggtcttgct
cttgggattgggatggttgttgactgttcaattgttgtaatagacaacatatataaatat
aggcaaaaaggagcaaagcttatttcatcttccatacttggagctcaagagatgatgatg
cctattacatcttcaacttttacttccatttgtgtttttggcccatttcttatttttaaa
tcagaacttggagtgtatggagatttttttaaagacttttcatttacgatcgttatttct
ttaggagtttctcttttagttgcgatttttttggttcccgttttatcaagccattatgtt
ggtttatacacaagttttcaaaaaaatattaagagtacttttattaggaaaattgacgct
ttttttgctagtatttattattttttagaatttttgtatatcaatttattaaatatagtt
ttaaatcacaaattgatttttgggctgattgttttttttagttttattggcagtttgttt
ttaggattattgctagatgtgacaacttttgataggggaaaagagaattcaattgttatt
aatttaaattttcctcataaaactagtttggaatatgcaaaattttattctaacagattt
ttagaaattgtaaaaagtgaggctaaaggatataaaagcattatttctactttggatgct
gacaggataactttcaacgtattgtttccacttaaggaagagtcaaaagatgagttgatt
aaaagtatagattacgatgctattaagtataaaattatggaccgtattggaaatctttat
cccgaatttaatattgagccttctagtggtaatgctttaggcggtggagattctattaaa
attaaaatttcagggaatgattttgaatatatgaaagattatggaaaaattttagtttct
atgttaaaaaaggaaattcctgaacttgtaaatccaagacttagtataaatgatgctcaa
cttcaaattggtgttgagatagacagagcgttagtttacaattatggcattgacatgaat
accattttaaatgagctaaaggccaatgttaatggtgttattgctggacaatatgtagag
aatgggcttaattatgatattgttcttaagcttgatagaatggatgttaaaaatttaaaa
gatttggaaaaaatatttattataaattcatctggagttaaaattcctttttcctcaata
gctacctttgaaaaaaccaataaagccgaatctatttacagagaaaatcaagctttaact
atttatcttaatgcaggtatttctccaaatgataatttaactcaagtaaccgcaaaagtt
gtagattttattaataataaggtgccgcataaagaggggacagtgcttaaggttgaagga
gaatataatgaattttcaaatattatgaatcagtttaaaataatcattatgatggctatt
gttgttgtgtttggcattatggcttctcaatttgaatcttttttaaaaccctttattatt
atttttacaattcctttaacagcaataggggttgtactcatacattttcttgcaggagaa
aaactttctatttttgctgcaattggaatgcttatgcttgttggtgttgtggtaaataca
ggaattgttcttgtagactataccggtttattaatcaagagaggatttggcctaagagaa
gcaattgttgaatcttgtcgttcaaggtttaggccaattttaatgtcttctttgacttca
ataataggtcttattcctatggcattttctagtggaagtggaaatgaacttttaaagcca
attgcattcacttttattggcggaatgacggctagcacatttcttactttgttttttatc
cccatgctttttgaagttttttccaatattgtttcaagctttaaatttaagttaaaaaga
gtgatgtctaatgtagatgttgaaaaatcattcaaaattaataattcaactaaaagtagt
tataataatctatttgaagaagatggggattga

DBGET integrated database retrieval system