KEGG   Borrelia afzelii (FLI): BAPKO_0214Help
Entry
BAPKO_0214        CDS       T00383                                 

Gene name
gtaB
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
baf  Borrelia afzelii (FLI)
Pathway
baf00052  Galactose metabolism
baf00500  Starch and sucrose metabolism
baf00520  Amino sugar and nucleotide sugar metabolism
baf01100  Metabolic pathways
baf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:baf00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BAPKO_0214 (gtaB)
   00052 Galactose metabolism
    BAPKO_0214 (gtaB)
   00500 Starch and sucrose metabolism
    BAPKO_0214 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    BAPKO_0214 (gtaB)
Enzymes [BR:baf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BAPKO_0214 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ABH01473
Position
208107..208943
Genome map
AA seq 278 aa AA seqDB search
MKGIILAAGYGTRFLPITKTIPKEMLPILNKPAIDYIIQEFIDSGIKDILLISSRRKKVL
EDYFDREIELENIFLKENKENELEKIKDKKINISFIRQKEMMGTGNALLYAKPWINREPV
IVAYPDDLHIGNPPLSLQLIKLHEKTGKSIISIIENPENINRYGVIELYKDEIHVKNIVE
KPKIGSEPSNKASIGRFLYNYEFFEHLEEGFKLHQKGEYYHIYALKKLMDQKKVLYKNIK
GKRIDIGTFEGYLEAIINFAKKDKNLMEIIKKGINEND
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtattattctggcagctgggtatggaacaagatttttaccaataacaaaaaca
attccaaaagaaatgttaccaattttaaacaaaccagccatagattatattatccaagaa
tttatcgattcaggaataaaagacattttattaataagctcaagacggaaaaaagttctt
gaagattattttgacagagaaattgaacttgaaaacattttcttaaaagaaaataaagaa
aatgaattagaaaagattaaagacaaaaaaattaacataagcttcataaggcaaaaagaa
atgatggggacgggaaatgcactactttatgcaaagccctggataaatagagaacctgta
attgtggcctaccctgacgatctgcatatcggaaatccaccattaagcttacaattgata
aaacttcatgaaaaaactggaaagagtataatatctatcattgaaaatccagaaaatata
aacagatatggagtaatagaactctacaaagacgaaatccatgtaaaaaacattgttgaa
aaaccaaaaattggaagtgagcctagcaataaagcatctattggaagatttttgtacaac
tatgaattttttgaacatttagaagaaggatttaaactacatcaaaaaggtgaatattat
cacatttatgctttaaaaaagctgatggatcaaaaaaaagtattatataaaaatattaag
ggaaaaagaattgatataggaacttttgagggctatttagaggcaataataaattttgca
aaaaaagataaaaatttaatggaaattataaaaaaaggtataaatgaaaacgattaa

DBGET integrated database retrieval system