KEGG   Borrelia afzelii (FLI): BAPKO_0616Help
Entry
BAPKO_0616        CDS       T00383                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamateligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
baf  Borrelia afzelii (FLI)
Pathway
baf00471  D-Glutamine and D-glutamate metabolism
baf00550  Peptidoglycan biosynthesis
baf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:baf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BAPKO_0616 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BAPKO_0616 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:baf01011]
    BAPKO_0616 (murD)
Enzymes [BR:baf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     BAPKO_0616 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:baf01011]
 Precursor biosynthesis
  Amino acid ligase
   BAPKO_0616 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C SYS1
Motif
Other DBs
NCBI-ProteinID: ABH01855
UniProt: Q0SMS3
Position
606144..607499
Genome map
AA seq 451 aa AA seqDB search
MRLDEIKNLNFLVMGLGLNGGGVALSRFLLKHGAKLVITDLKSEAELALSIDSLRDFDDQ
IRYVLGKHDVNDFKKADIVVKNPSVRPNNKYLKLAKRVETDISLFLIFNKNPIIAVTGTK
GKSTLVSLLYQALKKKYPRVKLGGNIGVSPLSFFDQLDGKSPLILELSSWQLQSLENFNP
ILSIITNVYNDHQNYYSNFDDYIIDKSKIFVNQTSGIVIIQDKAYYKYFSKFESKAKVIL
FSEFNPCNLDQDIFYSNKGEVYFNDNLIGSFFESQVVFMIPKLIAFFVAYYLNIDLNHMF
QILKNFKGIEHRLEFVKLVRNVMFYNDTASTIPDSTVLSVKSLKTNDNCINLIVGGTDKN
LDFSSFSKIINLVKAWILIKGSATVKIINVLEKSSIQYFVFDSLRGAVNYAFEISSPGDI
VLFSPASASFELFNNEFDRGLQFKKLVDMLG
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtttggacgaaattaaaaatttaaattttttagtcatgggtttaggtcttaatgga
ggaggagtagctctttctagatttttattaaagcatggagcaaagttagtaattactgat
cttaaaagtgaggcagaattagctttaagtattgattctttaagggattttgatgatcaa
attaggtatgttttaggtaaacatgatgtaaacgattttaaaaaagctgatattgttgtg
aaaaatcccagtgtgaggcccaataataaatatttaaagcttgcaaaacgagttgaaaca
gatattagtttatttttaatatttaataagaaccctataattgcagtaacaggcactaaa
ggtaaatcaactcttgtttcgcttttgtatcaggctttgaaaaaaaaatatccaagggta
aagcttggaggaaatattggtgtatctcctttaagtttttttgatcaacttgatggaaaa
tctcctttgattttagagctttcttcttggcagttacaatctttagagaattttaatcct
attcttagcattattacaaatgtttacaatgatcaccaaaattattattcaaattttgat
gattatattatcgataagtcaaaaatttttgtaaatcaaacctcaggaattgtgattatt
caggataaggcttattacaaatatttttcaaaatttgaatcaaaagccaaagttatttta
ttttccgaatttaatccttgtaatcttgatcaagatattttttattctaataaaggtgaa
gtatattttaatgacaacttgattggaagtttttttgagtcacaagttgtttttatgatc
cccaagcttattgctttttttgttgcgtattatttaaatatagaccttaatcatatgttt
cagattttaaagaattttaaaggcattgagcatagattagagtttgttaaattggttcga
aatgtaatgttttataatgatacagcttcaactattcctgattcgacggttttatctgtt
aaaagtttgaaaacaaatgataattgtattaacttaattgttgggggaactgataaaaat
cttgatttttcaagttttagtaagattataaatcttgtaaaagcttggatcttgataaaa
ggtagtgcaactgtaaaaattattaatgttttagaaaaaagtagcatacaatattttgta
tttgattctctaagaggtgccgtaaattatgcttttgaaatttcaagtccaggcgacatt
gttttattttcccccgctagtgcttcttttgagctttttaataatgagtttgataggggt
ttgcaattcaaaaaattagttgatatgcttggttaa

DBGET integrated database retrieval system