KEGG   Borrelia afzelii (FLI): BAPKO_0675Help
Entry
BAPKO_0675        CDS       T00383                                 

Gene name
recD
Definition
(GenBank) exodeoxyribonuclease V, alpha chain
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
baf  Borrelia afzelii (FLI)
Pathway
baf03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:baf00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    BAPKO_0675 (recD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:baf03400]
    BAPKO_0675 (recD)
Enzymes [BR:baf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BAPKO_0675 (recD)
DNA repair and recombination proteins [BR:baf03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BAPKO_0675 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 AAA_11 Viral_helicase1 UvrD_C_2 Helicase_RecD DUF2075 T2SSE AAA_22 AAA_5 RsgA_GTPase AAA AAA_16 RNA_helicase AAA_24 TrwB_AAD_bind Zeta_toxin AAA_28 DUF3349
Motif
Other DBs
NCBI-ProteinID: ABH01906
Position
complement(666937..668769)
Genome map
AA seq 610 aa AA seqDB search
MRDFLVLREFLKDKNKKFLTPELKLYEIIELLNINKKNYYKAQTLAKSINNENIVIFLIF
LFNYFDKGHLRANINLLAKDIQNTITFTKDNLEKTNKDYNKLIKMLKSLEIFGNLETIKD
IVSLLKKSNILMEFNKFKITTPLILENNIYIYTQKNYREEEDLIKQIIKRLENNKSELND
TEIQNIISNLNTNNLNKDQITSVRKALKSNFFLLSGGPGTGKTTTINYILKAINKTLNNK
KKRIVAIGAPTGKASLRLQASIDYSFENLEIECNTIQKLLGIKFINKKNLYDEENQLNFD
VIIIDEASMVDAYTFLKLLKATPITTKLIMVGDKNQLPSVNEGNVYSSLLGIENINKDNV
VDLKENFRSNKEINLLSKAIYKEDITLICKYINNNKNIQLKEIEKINLKKDLIEYANNLY
GKISTFNLKLLKDSKIETILETLLENIILSSKNFGKFGTKKLNEIIKTYLKKIYGNFIGQ
IIMITKTDYKNKLFNGERGVIFNENSKFYALFQRKDEKYKKINLDLLTNYEFSFATTIHK
SQGSEYKHIKVILENNPFLTKELMYTAITRAKDSLEIISNKETILKLSKKSCERDSKILE
HLNSFKEIDK
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgagagattttttagtattaagagaatttttaaaagataaaaacaaaaaattcttaact
cctgaacttaagctttatgaaataattgaacttttaaatatcaataaaaaaaattactat
aaagcacaaacacttgcaaagtccataaacaatgaaaacattgtaatatttttaatattt
ttatttaactactttgacaaaggccacttaagagctaatataaatctattagcaaaagac
attcaaaatacaataacattcacaaaagataacctagaaaaaaccaataaagattataac
aaattaataaaaatgctaaaaagtttagaaatatttgggaatctagaaactattaaagat
atagtctcgcttttgaaaaaaagcaacatactaatggaatttaataagtttaaaattaca
actcccctaatcctggaaaacaatatctacatttatactcaaaaaaactatagagaagaa
gaagatttaataaaacaaattataaaaagattagaaaacaataaaagtgaattaaatgac
accgaaatacaaaatataatatcaaatttgaacaccaataatttaaataaagatcaaatc
acatccgtgagaaaggcattaaaaagcaacttttttctattaagcgggggccctggaaca
ggcaaaactacaactattaactatatcttaaaggcaattaacaaaacattaaacaataaa
aaaaaaagaatagtagcaattggagcacctacaggaaaagccagcttaagactacaagca
agtatcgattattcattcgaaaatttagaaatagaatgcaatacaatccaaaaactattg
ggaatcaaatttataaacaaaaaaaatctatatgatgaagaaaatcaactaaattttgac
gtaataataattgacgaagcttcaatggtagatgcatatacttttttaaagctattaaaa
gcaacaccaataactactaaattaataatggtaggagataaaaatcaacttccatcggta
aatgaaggaaatgtatattcaagtcttctaggaatagaaaatataaacaaagataatgta
gtagatcttaaagaaaatttcaggagcaacaaagaaataaacttgctctcaaaagccata
tacaaagaagatatcaccttaatttgcaaatacattaataacaataaaaatattcaatta
aaagaaatagaaaaaataaatttaaaaaaagatctaatagaatatgcaaacaacttatat
ggaaaaatatccacttttaatcttaaattactaaaagattcaaaaattgaaacaatactt
gaaactttacttgaaaatataattttaagttcaaaaaattttggaaaatttggaactaaa
aaactaaatgaaataataaaaacttacctaaaaaagatctatggaaactttattgggcaa
ataataatgataactaaaactgactataaaaataaattatttaatggagaacggggtgtc
atttttaatgaaaattctaaattttatgctttattccaaagaaaagatgaaaaatataaa
aaaataaatctagatttactaacaaattatgaattcagctttgctacaacaatacacaaa
agccaaggatctgaatataaacatataaaagtaatattagaaaataacccttttttaaca
aaagaacttatgtatactgcaataacaagagctaaagatagcttagaaataatttctaat
aaagagactattcttaagctaagcaaaaaatcttgcgaaagagattcaaaaatactagaa
cacttaaactcatttaaagaaattgacaaataa

DBGET integrated database retrieval system