KEGG   Borrelia afzelii (FLI): BAPKO_0897Help
Entry
BAPKO_0897        CDS       T00383                                 

Gene name
arcB
Definition
(GenBank) ornithine carbamoyltransferase, catabolic
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
baf  Borrelia afzelii (FLI)
Pathway
baf00220  Arginine biosynthesis
baf01100  Metabolic pathways
baf01110  Biosynthesis of secondary metabolites
baf01130  Biosynthesis of antibiotics
baf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:baf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BAPKO_0897 (arcB)
Enzymes [BR:baf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     BAPKO_0897 (arcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N PALP
Motif
Other DBs
NCBI-ProteinID: ABH02121
UniProt: Q0SM07
Position
904351..905337
Genome map
AA seq 328 aa AA seqDB search
MYNLRNRSFLNLLDFTSKDIKYLLDLSIDLKKSKYAGIEVQKLKGKNIVIIFEKDSTRTR
CAFEIAAYDQGANITYLGPKGNQIGVKESMKDTARVLGRMYDAIGFRGFSQETVECLANY
SNVPVYNGLTDISHPTQILADLMTIKEHKGSLKGIKIVFCGDGRGNIANSLLKGCAIMGL
DFRIFAPKELFPDSNLTLKAKSLALKSGGKITITDSKEEAVKCADVVYTDVWVSMGEESN
WEDRINLLKLYQVNKELMCMAKDDAIFMHCLPAFHDLSTVVGRDIFDKYGLDGIEVTEEI
FESKNSVVFDVAENRVHAIKAVMVSTLG
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtataatttacgaaataggagctttttaaatcttttagattttacaagcaaagatatt
aaatatttacttgatttatcgattgatttaaaaaaatcaaaatatgcaggaattgaggtg
cagaaacttaaaggtaaaaatatagttataattttcgagaaagattcaacaagaacgcgg
tgtgcttttgaaattgcagcatatgatcaaggggcaaatattacgtatttaggacctaag
gggaatcaaataggcgtaaaagagtctatgaaagataccgctagagttttagggcgcatg
tatgatgccattgggtttagggggttttctcaagagactgttgaatgtttggcaaattat
tctaatgttcctgtttacaatggattgacagatatttctcacccaacccaaatactagct
gatttgatgacaataaaagagcataagggaagtttaaaaggaattaaaatagtattttgt
ggcgatggcagggggaatattgctaattctttgttaaaaggttgtgctattatgggacta
gatttcagaatttttgcccccaaagagctttttccagattccaatttgactcttaaggct
aagtctttagctttaaagagtgggggcaaaattacaattacggattctaaagaggaggct
gttaaatgcgctgatgttgtgtatactgatgtgtgggtatctatgggcgaggagagtaat
tgggaagatagaataaatcttctaaagctttatcaggtcaataaagaattgatgtgcatg
gcaaaagatgatgcaatatttatgcattgtttacctgcttttcatgatttgagtactgtg
gttggtagggatatttttgataaatatggacttgatggaattgaagttacagaagaaatt
tttgaaagtaaaaattcagttgtttttgatgttgctgaaaatagggtgcatgccattaaa
gccgttatggtatcgactttgggataa

DBGET integrated database retrieval system