KEGG   Borreliella afzelii K78: BAFK78_694Help
Entry
BAFK78_694        CDS       T03895                                 

Gene name
mvaA
Definition
(GenBank) 3-hydroxy-3-methylglutaryl-CoA reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
bafe  Borreliella afzelii K78
Pathway
bafe00900  Terpenoid backbone biosynthesis
bafe01110  Biosynthesis of secondary metabolites
bafe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bafe00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BAFK78_694 (mvaA)
Enzymes [BR:bafe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     BAFK78_694 (mvaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: AJY72661
Position
728999..730267
Genome map
AA seq 422 aa AA seqDB search
MELSKNFRHKSVLEKRQEIKNFLGLTFKDFFYNNANEDFLFNMIENYIGYLSFPIGIVKN
LKINGKYYSLPIATEESSVVAALNFAAKILENANLSYSLGEVLGISQIYVKSEKDLSKIF
IDLGDKVKTWIEPLLINMNQRGGGFRRLSTSYIKELGIQKLNIYLDTCDAMGANLLNSIA
ERVAECIFLEFGYECVLKVLSNDISEFTTRARFVLDFKYLLASKEDSWNLAKKIELISSI
GFYEEERAVTNNKGIMNGITGVCLATFNDTRALEASVHRFASKSGKYLPLSRFYTTDNAL
IGEIEIPLQIGIKGGVTSFNEASILSFRIMNVNSKSEFIGILSCVGLASNFAALRALAFN
GIQKGHMRLHVNKIFCLLKTKYNISDFEKDKLLLEMERKNIYSFDFAFKVLKKIRLENES
KV
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggaacttagtaaaaattttagacataaaagtgttttagaaaaaaggcaagagataaaa
aattttttgggattaacttttaaagattttttttataataatgccaatgaagattttctt
tttaatatgatagaaaattatattggatatttatcttttcctattggaattgtaaaaaat
ctgaaaataaatggtaaatactattctttacctattgcgacagaagaatcttctgttgtt
gctgccttaaattttgcggcaaaaattcttgaaaatgctaatttaagttattcgttgggt
gaagttttgggaatttctcaaatttatgtaaaatcggaaaaagatttaagtaaaattttt
attgatcttggtgataaagtcaagacctggattgaacctcttttaatcaatatgaatcaa
agaggaggtggatttagaagattgtcaactagctatattaaagagcttggtattcaaaaa
ttaaatatttatttggatacttgtgatgctatgggtgctaatttgctaaattcaattgca
gagcgtgtagcagaatgtatttttttagaatttggatatgaatgtgttttaaaggtttta
agcaatgatatttctgaatttacaaccagggcccgttttgttttggattttaagtatctg
ctagcaagcaaagaggattcttggaatttggctaaaaaaattgaacttatttctagcata
ggtttctacgaagaggagcgagctgttactaataataaaggtattatgaatggaattaca
ggtgtgtgtcttgcgacttttaatgatacaagagcgcttgaggcctctgttcacagattt
gcttcaaaaagtggcaaatatcttcctcttagtagattttatactaccgataatgctttg
attggagaaattgaaattcctttgcaaattggaattaaaggcggggttacatcttttaac
gaagcttcaattttaagctttagaattatgaatgtaaatagtaagagtgaatttattggc
attctctcttgtgtgggacttgctagtaattttgctgcattaagggctcttgcatttaat
gggattcaaaaggggcacatgagattgcatgttaataaaatattctgtcttttaaagaca
aaatataatatttctgattttgagaaagacaaattattattagaaatggaaagaaagaat
atttattcttttgattttgcttttaaagttttaaagaaaataaggttagagaatgaaagt
aaagtgtaa

DBGET integrated database retrieval system