KEGG   Borrelia afzelii HLJ01: BafHLJ01_0798Help
Entry
BafHLJ01_0798     CDS       T02298                                 

Gene name
pfk
Definition
(GenBank) diphosphate--fructose-6-phosphate 1-phosphotransferase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bafh  Borrelia afzelii HLJ01
Pathway
bafh00010  Glycolysis / Gluconeogenesis
bafh00030  Pentose phosphate pathway
bafh00051  Fructose and mannose metabolism
bafh00052  Galactose metabolism
bafh00680  Methane metabolism
bafh01100  Metabolic pathways
bafh01110  Biosynthesis of secondary metabolites
bafh01120  Microbial metabolism in diverse environments
bafh01130  Biosynthesis of antibiotics
bafh01200  Carbon metabolism
bafh01230  Biosynthesis of amino acids
bafh03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:bafh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BafHLJ01_0798 (pfk)
   00030 Pentose phosphate pathway
    BafHLJ01_0798 (pfk)
   00051 Fructose and mannose metabolism
    BafHLJ01_0798 (pfk)
   00052 Galactose metabolism
    BafHLJ01_0798 (pfk)
  Energy metabolism
   00680 Methane metabolism
    BafHLJ01_0798 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BafHLJ01_0798 (pfk)
Enzymes [BR:bafh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BafHLJ01_0798 (pfk)
Protein phosphatases and associated proteins [BR:bafh01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BafHLJ01_0798 (pfk)
Messenger RNA biogenesis [BR:bafh03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BafHLJ01_0798 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AFU75030
Position
767251..768594
Genome map
AA seq 447 aa AA seqDB search
MYRIKNENLDFKIDSLGECKQNNPLIDFYASEGSSHFVNEKNKIKFSVYRNEDEGDKYED
VLLEKAGPREKIYFVPRHVKAAITTCGGLCPGFNDVIRSIVRTLWKIYGVRNIYGVKFGY
QGLLPESNSPFINLNPDVVDDINKFGGTILGSSRGGIKPVEIVDTLERMNINMIFNIGGD
GTQKGSLLIAEEIEKRNLKIAVVGIPKTVDNDFMFVQKSFGFETAVEQAVAAVAGAHFEA
NSAYNGIGLVKVMGRDSGFIAAHTALSSNDVNFCLIPELDFDIEGPNGFLVHLERRLLEK
ESLEEIPHAVILIAEGAGQKYFDHFPRKKDDSGNLLYEDIGLYIKDKITEYFKAKNIQFT
LKYIDPSYIIRSSPANASDSLYCARLGSNAVHAAMSGKTKMLISLWSTKFVHIPIKMAVI
DRNKVNPNGSFWRDVLSSTGQPISMKN
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
gtgtatagaattaaaaatgaaaatttagattttaaaatagatagtttgggagaatgcaag
caaaacaatcctttgattgatttttatgctagcgaaggctcgtcgcattttgttaatgag
aaaaataaaattaagtttagtgtatatagaaatgaagatgagggagataagtatgaagat
gttcttttagaaaaagctggacctagagaaaaaatttattttgtgcccagacatgttaaa
gctgctattactacttgtggtggactttgtcctggttttaatgatgttattcgttctatt
gtgcgaactttatggaaaatttatggggttcgcaatatttatggggtaaaatttggatat
caaggtcttcttccggaatcaaattcaccttttattaatcttaatccagatgttgtggat
gatattaataaatttggaggtactattcttggctcttcaaggggtggtattaaacctgtg
gaaatagttgatactttagagagaatgaacattaatatgatttttaacattggcggagat
ggtactcaaaagggatctcttcttattgctgaggagatagaaaaaagaaatttgaaaata
gcagttgtaggcattcctaaaacggtagacaatgattttatgtttgttcaaaaatctttt
ggatttgagaccgctgtagaacaagcggttgcagctgttgctggagctcattttgaagct
aatagtgcttataatgggattggacttgttaaggttatgggacgggattctggctttatt
gctgctcatactgcactttcttctaatgatgttaatttttgtttaattccagagcttgat
tttgacatagaaggtcctaatggatttcttgttcatcttgaaagacggcttttagagaaa
gaaagcttagaagaaattcctcatgcagtaatattgatagcagaaggagcaggtcaaaaa
tattttgatcattttcctcgcaagaaagacgattctggaaatttgctttatgaggatatt
gggctttatattaaagataaaattacagaatattttaaagcaaaaaatattcagtttacc
cttaaatacattgatcctagctatattattagaagttcacctgctaatgctagtgattcg
ctttattgtgctagacttgggtcaaatgctgtacacgccgcaatgtctggtaagacaaaa
atgttgattagcctgtggagtacaaaattcgtgcacataccaattaagatggcggtaatt
gatagaaataaggttaatccaaatggttctttttggagagatgttctttcaagcacaggg
caaccgattagcatgaagaattaa

DBGET integrated database retrieval system