KEGG   Borreliella afzelii Tom3107: P612_03275Help
Entry
P612_03275        CDS       T03256                                 

Definition
(GenBank) exodeoxyribonuclease V subunit alpha
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
baft  Borreliella afzelii Tom3107
Pathway
baft03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:baft00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    P612_03275
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:baft03400]
    P612_03275
Enzymes [BR:baft01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     P612_03275
DNA repair and recombination proteins [BR:baft03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     P612_03275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 AAA_11 Viral_helicase1 UvrD_C_2 Helicase_RecD DUF2075 T2SSE AAA_22 RsgA_GTPase AAA_5 AAA AAA_16 AAA_24 RNA_helicase TrwB_AAD_bind Zeta_toxin AAA_28 DUF3349
Motif
Other DBs
NCBI-ProteinID: AIK18922
Position
complement(665490..667322)
Genome map
AA seq 610 aa AA seqDB search
MRDFLVLREFLKDKNKKFLTPELKLYEIIELLNINKKNYYKAQTLAKSINNENIVIFLIF
LFNYFDKGHLRANINLLAKDIQNTITFTKDNLEKTNKGYNKLIKMLKSLEIFGNLETIKD
IVSLLKKSNILMEFNKFKITTPLILENNIYIYTQKNYREEEDLIKQIIKRLENNKSKLND
TEIQNIISNLNTNNLNKDQITSVRKALKSNFFLLSGGPGTGKTTTINYILKAINKTLNNK
KKRIVAIGAPTGKASLRLQASIDYSFENLEIECNTIQKLLGIKFINKKNLYDEENQLNFD
VIIIDEASMVDAYTFLKLLKATPITTKLIMVGDKNQLPSVNEGNVYSSLLGIENINKDNV
VDLKENFRSNKEINLLSKAIYKEDITLICKYINNNKNIQLKEIEKINLKKDLIEYANNLY
GKISTFNLKLLKDSKIETILETLLENIILSSKNFGKFGTKTLNEIIKTYLKKIYGNFIGQ
IIMITKTDYKNKLFNGERGVIFNENSKFYALFQRKDEKYKKINLDLLTNYEFSFATTIHK
SQGSEYKHIKVILENNPFLTKELMYTAITRAKDSLEIISNKETILKLSKKSCERDSKILE
HLNSFKEIDK
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgagagattttttagtattaagagaatttttaaaagataaaaacaaaaaattcttaact
cctgaacttaagctttatgaaataattgaacttttaaatatcaataaaaaaaattactat
aaagcacaaacacttgcaaagtccataaacaatgaaaacattgtaatatttttaatattt
ttatttaactactttgacaaaggccacttaagagctaatataaatctattagcaaaagac
attcaaaatacaataacattcacaaaagataacctagaaaaaaccaataaaggttataac
aaattaataaaaatgctaaaaagtttagaaatatttgggaatctagaaactattaaagat
atagtctcgcttttgaaaaaaagcaacatactaatggaatttaataagtttaaaattaca
actcccctaatcctggaaaacaatatctacatttatactcaaaaaaactatagagaagaa
gaagatttaataaaacaaattataaaaagattagaaaacaataaaagtaaattaaatgac
accgaaatacaaaatataatatcaaatttgaacaccaataatttaaataaagatcaaatc
acatccgtgagaaaggcattaaaaagcaacttttttctattaagcgggggccctggaaca
ggcaaaactacaactattaactatattttaaaggcaattaacaaaacattaaacaataaa
aaaaaaagaatagtagcaattggagcacctacaggaaaagccagcttaagactacaagca
agtatcgattattcattcgaaaatttagaaatagaatgcaatacaatccaaaaactattg
ggaatcaaatttataaacaaaaaaaatctatatgatgaagaaaatcaactaaattttgac
gtaataataattgacgaagcttcaatggtagatgcatatacttttttaaagctattaaaa
gcaacaccaataactactaaattaataatggtaggagataaaaatcaacttccatcggta
aatgaaggaaatgtatattcaagtcttctaggaatagaaaatataaacaaagataatgta
gtagatcttaaagaaaatttcaggagcaacaaagaaataaacttgctctcaaaagccata
tacaaagaagatatcaccttaatttgcaaatacattaataacaataaaaatattcaatta
aaagaaatagaaaaaataaatttaaaaaaagatctaatagaatatgcaaacaacttatat
ggaaaaatatccacttttaatcttaaattactaaaagattcaaaaattgaaacaatactt
gaaactttacttgaaaatataattttaagttcaaaaaattttggaaaatttggaactaaa
acactaaatgaaataataaaaacttacctaaaaaagatctatggaaactttattgggcaa
ataataatgataactaaaactgactataaaaataaattatttaatggagaacggggtgtc
atttttaatgaaaattctaaattttatgctttattccaaagaaaagatgaaaaatataaa
aaaataaatctagatttactaacaaattatgaattcagctttgctacaacaatacacaaa
agccaaggatctgaatataaacatataaaagtaatattagaaaataacccttttttaaca
aaagaacttatgtatactgcaataacaagagctaaagatagcttagaaataatttctaat
aaagagactattcttaagctaagcaaaaaatcttgcgaaagagattcaaaaatactagaa
cacttaaactcatttaaagaaattgacaaataa

DBGET integrated database retrieval system