KEGG   Borrelia afzelii (Maryland): BafPKo_0175Help
Entry
BafPKo_0175       CDS       T02093                                 

Gene name
gidA
Definition
(GenBank) tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA
  KO
K03495  tRNA uridine 5-carboxymethylaminomethyl modification enzyme
Organism
bafz  Borrelia afzelii (Maryland)
Brite
KEGG Orthology (KO) [BR:bafz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bafz03016]
    BafPKo_0175 (gidA)
   03036 Chromosome and associated proteins [BR:bafz03036]
    BafPKo_0175 (gidA)
Transfer RNA biogenesis [BR:bafz03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    BafPKo_0175 (gidA)
 Prokaryotic Type
    BafPKo_0175 (gidA)
Chromosome and associated proteins [BR:bafz03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    BafPKo_0175 (gidA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GIDA GIDA_assoc Pyr_redox_2 FAD_oxidored FAD_binding_2 HI0933_like Thi4 Pyr_redox Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AEL69408
UniProt: Q0SNY6
Position
complement(179236..181101)
Genome map
AA seq 621 aa AA seqDB search
MDFDAIVIGGGHAGIEAALAISRLNFKTLMITQNLDTIGKLSCNPAIGGLAKGNMVREID
ALGGEMGRIIDFSMIQFRVLNKSRGPAVQAPRAQADKLMYQTKAKETLERQDNLDLFQDT
VVDFLLNSMRNEIEGVVTERGNKFRSSVVVLTTGTFLRGKIFIGEYRANMGRLAEFSAYG
LDKTLLGLGFEMGRLKTGTPARIHRKSVDFSKTEVQFGDSDIIPFSFSNGKLDKSQLSCY
VTYTNKRTHEIISENMHLSPLYSGEIVGNGPRYCPSIEDKIVKFKDKDRHQIFIEPEGFN
TEEMYLNGLSSSLPENVQQKLINSIEGLEHAVITRPGYAVEYDYINPIELYPSLESKRVK
GLFIAGQTNGSSGYEEAAAQGLMAGINAALRLQNKKPMILTRTSSYIGVLIDDLVTKGTK
EPYRMFTSRAEHRLNLRHDTSDKRLIKIGYDLGLVDEERYSKYLFKKRRVEEIKELLKQR
RLSLKDIADEQLKKHVNKDFYHILKDPSISLDNLIKIDPSLSDSKVILEQVELDIKYEGY
INRQKDLIKKLHNLELVKLPFDFNYGIIEGLSREAREKFSKVQPATLAQASRIPGIRNTD
ITVLFIYFSNPKNKVVLNFSV
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atggattttgacgcaattgttattggaggagggcatgcagggattgaagctgcgcttgct
atttcaaggctaaattttaaaactttaatgattactcaaaatttagatacaatcggcaag
ctttcttgcaatcctgctattggtggacttgctaagggcaatatggttagggaaattgat
gctcttggcggtgaaatgggtcgcattattgactttagcatgattcagtttagagtttta
aacaaaagtcgtgggcctgcggtccaagctccacgtgctcaagctgataaattaatgtac
caaaccaaggcgaaagaaactttagagcgtcaagataatcttgatctttttcaagataca
gttgttgattttcttcttaattctatgagaaatgaaattgagggtgttgttacagagcga
ggtaataagtttagatcgagtgttgtagtacttacaacagggacatttcttcgaggcaaa
atatttattggtgagtatagagctaatatgggtagacttgctgaattttctgcttatgga
cttgataaaactttacttggtcttggatttgaaatgggtaggcttaaaacgggcactccg
gcaagaattcatagaaaaagtgtggatttttcaaagacagaggttcaatttggagattca
gacatcattcccttttctttttcaaatggcaagttagataaatctcagctttcatgttat
gtgacctacactaataaaagaactcacgaaataattagtgaaaatatgcacttgtcaccc
ctttattctggtgagattgtgggcaatggtccaagatattgtccttctattgaggataaa
atagtaaaatttaaagataaagacaggcatcaaatttttattgagcctgaagggtttaat
acggaagaaatgtatcttaatggtcttagctcttctttgcctgaaaatgttcagcaaaaa
ttgattaatagtattgaaggtcttgagcatgctgttattacaaggcctggttatgccgtt
gagtatgattatataaatccaattgaactttatccaagtcttgagagcaaaagagttaaa
gggctttttatagcaggtcagaccaatggctcttcaggatatgaggaggcagcagctcaa
gggctaatggcaggaattaatgctgctcttagacttcaaaataaaaagccaatgattcta
acaagaactagttcttatattggagttcttattgatgatcttgttactaaaggtactaaa
gagccttacagaatgtttacttctagggctgaacatagacttaatttaaggcacgatact
agtgataagcgtttgattaagattggatatgatcttggacttgttgatgaggagagatat
tcaaaatatctttttaagaaaagaagagttgaagagataaaggagcttttaaagcaaagg
cgtcttagtttaaaagatattgctgatgaacaattaaaaaaacatgttaacaaagatttt
tatcatatcttaaaagatccttctattagtttagataatttaataaagattgatccaagt
ttgagcgattcaaaagtaattttagaacaagttgagttagatattaaatatgaaggctat
attaatagacaaaaagatttgattaaaaaacttcataatctagaacttgtcaagcttcca
tttgattttaattatggaattattgaaggtctctcaagagaagctagagagaaattttct
aaggttcaaccagctactcttgctcaagcaagtcgaattcctggaataagaaatacggat
attactgttttgtttatatatttttcaaatcctaaaaataaggtagttttaaatttttct
gtatga

DBGET integrated database retrieval system