KEGG   Borrelia afzelii (Maryland): BafPKo_0181Help
Entry
BafPKo_0181       CDS       T02093                                 

Gene name
csrA
Definition
(GenBank) carbon storage regulator
  KO
K03563  carbon storage regulator
Organism
bafz  Borrelia afzelii (Maryland)
Pathway
bafz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bafz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BafPKo_0181 (csrA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bafz03019]
    BafPKo_0181 (csrA)
Messenger RNA biogenesis [BR:bafz03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Others
     BafPKo_0181 (csrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CsrA Fur_reg_FbpB
Motif
Other DBs
NCBI-ProteinID: AEL69414
UniProt: Q0SNY0
Position
186650..186895
Genome map
AA seq 81 aa AA seqDB search
MLVLSRKVNESIKINSNIEVLILEIKKDTVKIAIKAPENIKIFRSEIYEFIIEENKKSIL
KDKHNIGKIKSLFNHYFKNEN
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
atgctagtattgtcaagaaaagtaaatgaaagtattaaaataaactctaatattgaggtt
ttaatattagagataaaaaaagatactgttaaaatcgcaattaaagctcctgaaaacatt
aaaatatttagatctgaaatttatgaatttattatagaagaaaataaaaaatcaatacta
aaagacaaacacaatataggcaaaattaaaagtctattcaatcattattttaagaatgaa
aattaa

DBGET integrated database retrieval system