KEGG   Borrelia afzelii (Maryland): BafPKo_0183Help
Entry
BafPKo_0183       CDS       T02093                                 

Definition
(GenBank) uncharacterized P-loop hydrolase UPF0079 family protein
  KO
K06925  tRNA threonylcarbamoyladenosine biosynthesis protein TsaE
Organism
bafz  Borrelia afzelii (Maryland)
Brite
KEGG Orthology (KO) [BR:bafz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bafz03016]
    BafPKo_0183
Transfer RNA biogenesis [BR:bafz03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    BafPKo_0183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TsaE AAA_23 NACHT dNK Pox_A32 AAA_29 T2SSE AAA_18
Motif
Other DBs
NCBI-ProteinID: AEL69416
UniProt: Q0SNX8
Position
complement(187525..187938)
Genome map
AA seq 137 aa AA seqDB search
MILEFKSEKKMINFSKSFFYPLPIGKIFVLSGDMGSGKTSFLKGLALNLGISYFTSPTYN
IINVYDFIDFKFYHVDLYRVFSLEEFELIGGLEMLVDLDSIIAIEWPQIALSILPKDRLF
SLAFKIVGSGRVIEFNG
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
ttgattttagaatttaaatcagaaaaaaaaatgataaatttttccaaatcttttttttat
cctttaccaattggtaaaatatttgttttaagcggtgatatgggatctgggaaaaccagt
tttttaaaggggcttgctcttaaccttggaatttcttattttacaagtccaacttataat
attattaatgtttatgattttatagatttcaagttttatcatgttgatttatatcgggtg
ttttctttggaagaatttgagcttattgggggattggaaatgcttgtggatcttgactca
attattgctattgaatggccacaaattgctttaagtattcttccaaaagacagattattt
tctttggcttttaaaatagtcggttcaggtagggttatagaatttaatggttaa

DBGET integrated database retrieval system