KEGG   Borrelia afzelii (Maryland): BafPKo_0184Help
Entry
BafPKo_0184       CDS       T02093                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bafz  Borrelia afzelii (Maryland)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEL69417
UniProt: Q0SNX7
Position
complement(187935..188195)
Genome map
AA seq 86 aa AA seqDB search
MQLISLNNIEKQESFIYYRNVYFADVIYKYNDVLEIKKVKFVIEVTPLGEKHVTIDFIDF
LNYPVLKLMVAIKRRIIDLEFKGKLP
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcttatttctcttaataatattgaaaagcaagagagttttatttattatagaaat
gtatattttgctgatgttatttataaatataacgatgtcctagagatcaaaaaagtaaag
tttgtaattgaggtcacgcccttaggagaaaagcatgtcactattgattttatagatttt
ttaaattatcctgttttaaagttaatggttgcaattaaaaggcgtataattgatttggaa
tttaaaggtaagcttccttga

DBGET integrated database retrieval system