KEGG   Borrelia afzelii (Maryland): BafPKo_0187Help
Entry
BafPKo_0187       CDS       T02093                                 

Gene name
infC
Definition
(GenBank) translation initiation factor IF-3
  KO
K02520  translation initiation factor IF-3
Organism
bafz  Borrelia afzelii (Maryland)
Brite
KEGG Orthology (KO) [BR:bafz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bafz03012]
    BafPKo_0187 (infC)
   03029 Mitochondrial biogenesis [BR:bafz03029]
    BafPKo_0187 (infC)
Translation factors [BR:bafz03012]
 Eukaryotic Type
  Initiation factors
   MTIFs
    BafPKo_0187 (infC)
 Prokaryotic Type
   BafPKo_0187 (infC)
Mitochondrial biogenesis [BR:bafz03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BafPKo_0187 (infC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IF3_C IF3_N mIF3
Motif
Other DBs
NCBI-ProteinID: AEL69420
UniProt: Q0SNX3
Position
complement(189001..189561)
Genome map
AA seq 186 aa AA seqDB search
MINRNANRDRDRSRSNDKELKINYRIKAREVRVIFENGTQEVLSIEDAIKKAKEAGLDLV
EVSPNVSPPVCKIIDYGKYKFHQEKRQKEQKKNQKVIKLKEVRMQPKIDTHDLDFKSKNI
LSFLKDGNKVKVTIRFRGRELAHTYLGYGILNSILEKVGDVNYVLESAAKMEGKTMFLIV
APKFKK
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgataaatagaaatgccaatagagatagggataggtccagatcaaatgacaaggaattg
aaaattaattacagaattaaggctcgtgaggtaagagttatttttgaaaatggaacacaa
gaggttttgtcgattgaagatgctattaaaaaagcaaaagaagctgggcttgatttggtt
gaggtttctcccaatgtgtctcctccggtttgtaaaattattgattatggaaaatataaa
ttccatcaagaaaagcgtcaaaaagagcaaaaaaagaatcaaaaagtaattaagcttaag
gaagtcagaatgcaacccaagatagatactcatgaccttgattttaaatcaaaaaacatt
ttgagttttctcaaagacggcaataaggttaaagttacaataagatttagaggtcgtgaa
cttgctcatacatatttaggatatggtattttaaatagtatccttgaaaaagtaggggat
gtgaattatgttttggagtctgcagctaaaatggaagggaagacaatgtttttgattgta
gcgcctaagtttaaaaaataa

DBGET integrated database retrieval system