KEGG   Borrelia afzelii (Maryland): BafPKo_0210Help
Entry
BafPKo_0210       CDS       T02093                                 

Definition
(GenBank) tetratricopeptide repeat family protein
Organism
bafz  Borrelia afzelii (Maryland)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_2 TPR_8 TPR_1 TPR_16 TPR_19 TPR_12 TPR_17 TPR_6 TPR_14 TPR_7 TPR_11 ANAPC3 TPR_10 PknG_TPR TPR_20 Tetraspannin Fis1_TPR_C
Motif
Other DBs
NCBI-ProteinID: AEL69438
UniProt: Q0SNV2
Position
211705..214746
Genome map
AA seq 1013 aa AA seqDB search
MNKKRTNFSVLLLLIFLLILSFGGFGYYIYQSKLNDKNREIMLNEVKNSVIDRNYKKAYS
VAKLLQDKYPQNEDIAMLTNTLAEIANSSPFESNDLQRDSANQILDKIKGQGNVKTNVNE
NFDIAFNNRYIKDSTITENYSDRNDDVGIEDEDISEFKKSKIPEKINQNTQPKKEDQTIQ
HPNPKLNVNDQKNLFSLEKLKKNLSENSNNENILNNPQKIENNTQNTNLPKEKNSEHILK
TLDNNKYLNNNNAISLKEMPSNSKEESDLSPPSQTIIGKIHRPYSYLIKKELYEILDNIN
TGRVTLGKNRLKELIKKGLSNKFQKVNELIESLKTKEASNLLLTLIKKDIEPNLIDIPKD
PYKKDIFQLNKEKEDNRIQHLEDLKSKVYSIKPGDLENSKTRQQAIKDLNEFLITNPNDA
YASKTLAQANKIQQLEDLKSKVYSIKPGDLENPKTRQQAIKDLNEFLITNPNDTYASKTL
AQANKIQQLEDLKSKVYSIKPGDLENPKTRQQAIKDLNEFLITNPNDAYASKTLAQANKI
QQLEDLKSKVYSIKPGDLENPKTRQQAIKDLNEFLITNPNDAYASKTLAQANKIQQLEDL
KSKVYSIKPGDLENPKTRQQAIKDLNEFLITNPNDAYASKTLAQAYENDGDLLKAESVYD
KITKLTNAKEDYYKLGIIRFKLKKYEHSIEAFNQTIRLDPKHKKAHNNKGIALILLNKNK
QAIESFEKAIQIDKNYDTAYYQKGIAEEKTGDMQQAFVSFKNAYDLNKKLNYALKAGIVS
NNLGNFKKSEEYLGFFNDNVKKPNEIAIYNLSIAKFENNKLEESLEIINKAINLNPEKSE
YLYLKASINLKNENYQNAIPLYNLVIEKNPENISAYINLAKAYEKSGNKTQAISTLEKII
NKNNKLALNNLGILYKNQKNYQKAIEIFEKAIINSDIEAKYNLATTLIEINDNTRAKDLL
KEYTKLKPNNPEALYALGIIEYNENNNDQTLRELIKKFPNYKKNGNIKKIIGI
NT seq 3042 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaacgtacaaatttttcggtattattgcttttaattttcttacttatctta
tcatttggaggctttggatactatatatatcaaagcaaattaaatgacaaaaatcgagaa
ataatgctaaacgaagttaaaaacagtgtaatagatcgaaactataaaaaagcatattct
gttgcaaaacttctgcaagataaatacccgcaaaatgaagacattgcaatgcttacaaat
acattagcagaaatcgccaacagtagcccttttgaatcaaacgacttacaaagagattct
gcaaatcaaatcttagataagatcaaaggtcaaggcaatgtaaaaacaaatgtaaacgaa
aattttgatatcgcatttaataatagatacattaaagacagcacaataacagaaaactac
tctgacagaaacgatgacgttggtattgaagatgaagacatatctgaatttaaaaaaagc
aaaatcccagaaaaaataaatcaaaatacacaaccaaaaaaagaagatcaaacaatacaa
catccaaatcccaaattaaatgttaatgatcaaaaaaatttattttctttggaaaaatta
aaaaaaaatttaagtgaaaactcaaacaatgaaaatattttaaacaacccccaaaaaata
gaaaataatacgcaaaacacaaatttacccaaagaaaaaaattcagaacatattttaaaa
accttagacaacaataaatatttaaacaataataatgctatatctttaaaagagatgcct
tcaaattctaaagaagaaagtgacctttctccacccagccaaacaataataggaaaaatt
cataggccatatagttacttaataaaaaaagagctttacgaaatattagacaatattaat
actggtagagtcacacttggaaaaaacagattaaaagaattaattaaaaagggtttaagc
aataaatttcaaaaagtgaatgaattgattgaaagcttaaaaactaaagaagcctccaat
ttactattaaccttaataaaaaaagacattgagccaaatttaattgatataccaaaagat
ccttacaaaaaagacatttttcaattaaataaagaaaaagaagataatagaatacaacac
ttggaagaccttaaatctaaggtctattcaataaagcctggtgatcttgaaaactcaaaa
acacgtcaacaagccattaaagatttaaatgaattcttgataaccaatcccaatgatgcc
tatgcctctaaaactttagctcaagctaataaaatacagcaattggaagaccttaaatct
aaggtctattcaataaaacctggtgatcttgaaaacccaaaaacacgtcaacaagctatt
aaagatctaaatgaattcttaataaccaatcctaatgatacctatgcctctaaaacttta
gctcaagctaataaaatacagcaattggaagaccttaaatctaaagtttattcaataaaa
cctggtgatcttgaaaacccaaaaacacgtcaacaagccattaaagatttaaatgaattc
ttaataaccaatcctaatgatgcctatgcctctaaaactttagctcaagctaataaaata
cagcaattggaagaccttaaatctaaagtttattcaataaaacctggtgatcttgaaaac
ccaaaaacacgtcaacaagccattaaagatctaaatgaattcttaataaccaatcctaat
gatgcctatgcctctaaaactttagctcaagctaataaaatacagcaattggaagacctt
aaatctaaagtttattcaataaaacctggtgatcttgaaaacccaaaaacacgtcaacaa
gccattaaagatttaaatgaattcttgataaccaaccctaatgatgcctatgcctctaaa
actttagctcaagcttatgaaaacgatggagatttactaaaagcagaaagcgtatatgac
aaaattaccaaactcacaaatgccaaagaagattactataaacttggaattattagattt
aagcttaaaaagtatgaacactcaatagaggcatttaatcaaacaataaggctcgatcca
aaacacaaaaaagcacataataacaaaggaatagctttaatactgctaaataaaaacaaa
caagcaatagaatcttttgagaaagcaatacaaattgataaaaattatgacactgcctac
taccaaaaaggaatagcggaagaaaaaactggcgatatgcaacaagcatttgtaagtttt
aaaaatgcctacgatctaaacaaaaaactcaattacgcattaaaagctggaatagtatca
aacaacctgggcaacttcaaaaaaagtgaagagtatttgggattttttaatgataatgta
aaaaaacctaacgaaattgctatttataatctatcaatagcaaaatttgaaaacaataaa
cttgaagaatctcttgaaataataaacaaggccatcaatttaaatccagaaaaaagtgaa
tatttatatttaaaagcatccataaatcttaaaaacgaaaattatcaaaatgctatacca
ctttacaacttggtaattgaaaaaaaccctgaaaatatttcagcttacataaacctagca
aaagcatacgaaaaatcgggaaataaaactcaagcaatctcaactcttgaaaagataata
aacaaaaacaataaattagccttaaacaatcttggaatactttacaaaaaccaaaaaaat
tatcaaaaagcaattgaaatttttgaaaaagcaataatcaattcagatattgaagcaaaa
tataatcttgcaaccactctaattgaaattaatgataatacaagagctaaagaccttcta
aaggaatatacaaaattaaaaccaaacaatccagaagccttatatgcactcggaataata
gaatataatgagaacaataatgatcaaacattaagggaacttattaaaaaatttccaaat
tataaaaaaaatggaaatattaaaaaaataataggaatataa

DBGET integrated database retrieval system