KEGG   Borrelia afzelii (Maryland): BafPKo_0211Help
Entry
BafPKo_0211       CDS       T02093                                 

Gene name
mutL
Definition
(GenBank) DNA mismatch repair MutL family protein
  KO
K03572  DNA mismatch repair protein MutL
Organism
bafz  Borrelia afzelii (Maryland)
Pathway
bafz03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:bafz00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    BafPKo_0211 (mutL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bafz03400]
    BafPKo_0211 (mutL)
DNA repair and recombination proteins [BR:bafz03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    Molecular matchmaker
     BafPKo_0211 (mutL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_mis_repair MutL_C HATPase_c_3 HATPase_c
Motif
Other DBs
NCBI-ProteinID: AEL69439
UniProt: Q0SNV1
Position
214753..216588
Genome map
AA seq 611 aa AA seqDB search
MNKIRFLDKYLVQKIAAGESIDRPCSILRELLDNSIDSGATKIEVFLEEGGIQKILIIDN
GSGISQEDLKICYLPHTTSKISSEEDLRKIETLGFRGEALSSIAICSNISITSSTTGNES
YQIEVENGIEKCFKKQPAINGTIVDVTKIFHNFPARKRFLKQEPIETKMCLKVLEEKIIT
HPEINFEINLNQKLRKIYFKESLIDRVQNVYGNVIENNKFKVLKKEHENIKIEIFLAPAN
FSKKSKRHIKTFVNRRPIDQKDLLEAITNGHSRILSPGNFPICYLFLEINPEYIDFNVHP
QKKEVRFFNLPFLFKLISDNINNFFDKDTNNYHDVIIKRQLTDDDHLIEMINQSENFNKT
STYDVPQNKNLETEDNTNEPNKNMIQKDVGLRKYNSIIENRPSLKENITNIFSDSFLEFE
EPPNKNEEEDIKFNYIGQIFSEFLIVEKANEIYFIDQHAVHEKIIYEKLRNSKKTIQKLL
IPIEFTIVDKNIEKIIDSEIEEYKKMDIIISKIGSEKYQLESIPNICNQYENTLINFFQS
RRSRTINSLESDLYATIACRKAVKTNDILSVEFSKYLINEFFKLEIKHCPHGRKIYYKIS
KFELEKKVDRA
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaataagattcttagataaatacttggttcaaaaaatagcagcaggagaatca
atagacagaccatgttcaatattaagagaattgctagacaattcaatagattctggggct
actaaaattgaggtctttcttgaagaagggggaattcaaaaaatcttaataatagataat
ggaagcggaataagtcaagaggatttaaaaatctgctatttaccacacactacttcaaaa
atatcctcagaagaagatttaagaaaaatagaaactctaggatttagaggagaggctctc
tccagcattgcaatttgctccaacatttcaataacaagctcaacaactggcaatgaaagc
tatcaaatagaagtggaaaatggcattgaaaaatgctttaaaaaacaacctgccataaac
ggaacaatagtagatgttacaaaaatatttcacaactttccagcaagaaaaagattctta
aagcaagaacctattgaaacaaaaatgtgtctaaaagttttagaagaaaaaataataacc
catcctgaaatcaatttcgaaattaatttgaatcaaaaactaagaaaaatttactttaaa
gaatcgttaattgatagagtacaaaatgtatatgggaatgtaatagaaaataataaattt
aaggtcttaaaaaaagaacatgaaaatataaaaatagaaatatttttagcaccagctaat
ttttctaaaaaaagtaaaagacatattaaaacatttgttaacagaagacctatcgatcaa
aaagatctcttagaagcaataactaatggtcacagcagaatactttcccctggcaacttc
ccaatatgttatttatttttagaaataaaccctgaatatattgactttaatgtccaccct
caaaaaaaagaagtaagatttttcaatcttccatttttatttaaactaatctctgacaat
attaataattttttcgataaagatacaaataactaccacgacgtaataatcaaaagacaa
ttaacagatgatgatcatttaatagaaatgataaaccaatcagaaaactttaataaaacc
agcacatatgatgtaccacaaaacaaaaatttagaaacagaagataatacaaatgaacca
aacaaaaacatgatacaaaaggatgttggccttaggaaatataattcaattatagaaaat
agaccatcacttaaggaaaacatcacaaacattttctctgacagctttttagaatttgaa
gaaccaccaaacaaaaatgaagaagaagatataaaatttaactatataggacaaatattc
tctgaatttttaatcgttgaaaaagcaaatgaaatttacttcatagaccaacacgcagtt
cacgaaaaaataatatatgaaaaacttagaaattcaaaaaaaactattcaaaagcttcta
ataccaattgaattcacaatagttgataaaaacatagaaaaaattatagatagtgaaatc
gaagaatataaaaaaatggacattataatctctaaaataggctctgaaaaatatcaactt
gaatctattcctaatatttgcaatcaatatgaaaatactcttattaacttttttcaatca
agaagaagtagaacaataaattctcttgaatctgatttatatgcaactattgcctgtaga
aaggccgttaaaacaaatgacatattaagcgttgaatttagcaaatatttaataaatgaa
ttttttaaactagaaattaaacattgccctcatggacgaaaaatttattacaaaatatct
aaatttgagcttgaaaaaaaagttgacagagcataa

DBGET integrated database retrieval system